KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3D6.09
Entry
SPBC3D6.09        CDS       T00076                                 
Symbol
dpb4
Name
(RefSeq) DNA polymerase epsilon subunit Dpb4
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC3D6.09 (dpb4)
   03410 Base excision repair
    SPBC3D6.09 (dpb4)
   03420 Nucleotide excision repair
    SPBC3D6.09 (dpb4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC3D6.09 (dpb4)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC3D6.09 (dpb4)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC3D6.09 (dpb4)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SPBC3D6.09 (dpb4)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    SPBC3D6.09 (dpb4)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    SPBC3D6.09 (dpb4)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      SPBC3D6.09 (dpb4)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone Striatin
Other DBs
NCBI-GeneID: 2540966
NCBI-ProteinID: NP_595521
PomBase: SPBC3D6.09
Ensembl: SPBC3D6.09
UniProt: P87174
Structure
Position
II:1285965..1287121
AA seq 210 aa
MNQDKSKETSELDDLALPRSIIMRLVKGVLPEKSLVQKEALKAMINSATLFVSFLTSASG
EIATNNNRKILMPQDVLNALDEIEYPEFSKTLKKHLEAYELALKEKRLKLPNVSDVDNRK
KAKIDAHDTTPLDEEKDELEEERIAEDIAQNEVEQNIDDVEDLEEVNDTLDANAESPQIE
TIHLTDATGNPIEDSSESDSEESLQLNDSS
NT seq 633 nt   +upstreamnt  +downstreamnt
atgaatcaagataaatcgaaagaaacttccgaattggatgatctggcgcttcctcgatcg
atcattatgcgattagtcaaaggtgtcttacctgaaaagagtcttgtacaaaaagaagct
ctcaaggctatgatcaattcagcaactctttttgttagttttctaacatccgcttctggg
gaaattgctacgaataataacagaaaaattcttatgcctcaagacgttttgaatgcgctc
gatgaaattgagtatccagaattctctaaaacgttaaaaaaacatctcgaagcatatgag
cttgccttgaaagaaaaacgattgaaactccctaacgtatcagatgttgataacagaaag
aaagccaaaatagacgcgcatgacactactcctctagatgaagaaaaagacgaattagaa
gaagaacgaattgcggaggatatagcacaaaatgaagttgagcaaaatattgatgatgtg
gaggacctcgaagaagtgaatgatacattagacgcaaacgcagaatctcctcaaatagaa
accattcatcttacagatgctacgggaaacccaattgaagatagctctgaatccgactca
gaagaatctcttcaacttaatgattcttcgtaa

DBGET integrated database retrieval system