KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3D6.10
Entry
SPBC3D6.10        CDS       T00076                                 

Gene name
apn2
Definition
(RefSeq) AP-endonuclease Apn2
  KO
K10772  AP endonuclease 2 [EC:4.2.99.18]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SPBC3D6.10 (apn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC3D6.10 (apn2)
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SPBC3D6.10 (apn2)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     SPBC3D6.10 (apn2)
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2 zf-GRF QWRF SR-25
Other DBs
NCBI-GeneID: 2540679
NCBI-ProteinID: NP_595522
PomBase: SPBC3D6.10
UniProt: P87175
Position
II:join(1287406..1288198,1288236..1289014)
AA seq 523 aa
MRILSWNVNGIQNPFNYFPWNKKNSYKEIFQELQADVICVQELKMQKDSFPQQYAVVEGF
DSYFTFPKIRKGYSGVGFYVKKDVAIPVKAEEGITGILPVRGQKYSYSEAPEHEKIGFFP
KDIDRKTANWIDSEGRCILLDFQMFILIGVYCPVNSGENRLEYRRAFYKALRERIERLIK
EGNRKIILVGDVNILCNPIDTADQKDIIRESLIPSIMESRQWIRDLLLPSRLGLLLDIGR
IQHPTRKGMFTCWNTRLNTRPTNYGTRIDYTLATPDLLPWVQDADIMAEVMGSDHCPVYL
DLKEEYEGKKLSNFLSHSKEPPLLSTAHHSAYRPSKNIHSMFQHFNSMKKNKNNSPTQSE
NVSASASSGSSPTVSRANSVIDVDAYPPEKRRRKEQSKLLSFFAKQKEEKEETNKTEDVS
IEVLDNNNESDIGLTVKKKVENGNAWKQIFSERAPPLCEGHKEPCKYLTVRKPGINYGRK
FWICARPVGELIKNSNAVSEEDTQPFQCRFFIWDSDWRANSKD
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgcgaattctaagttggaatgtgaacggtatacagaatccattcaattattttccatgg
aataaaaaaaattcctacaaagagatatttcaagagttacaggctgatgtaatatgtgtt
caagaattgaaaatgcagaaagacagctttcctcaacaatatgcagttgttgagggattc
gacagttattttacatttcctaagatcagaaaaggctatagtggggttggattttatgta
aaaaaagatgttgctattccagtgaaagcagaagagggaattactggcatcctgccagta
cgaggacaaaaatattcatattcagaagcaccggagcatgaaaagataggatttttccca
aaagacattgacagaaaaactgctaattggattgatagtgaaggaaggtgtatattatta
gattttcagatgttcatcctaatcggtgtttactgtccagtaaactctggagaaaataga
ctagaatatcgacgggccttttataaagccttacgagaaagaattgaaagattgataaag
gaaggaaatcgaaaaatcattctcgttggggatgtgaatattttgtgtaatcctattgac
actgctgatcaaaaagacattattcgagagagtcttattccaagcatcatggaatcaaga
caatggatacgtgatttattactaccaagcaggttgggactactgttggacattggccgt
attcaacatcctactcggaaaggaatgtttacatgttggaatacaagacttaatacaagg
cccacaaattatggtacgagaattgattacactttggcaacacccgatttattaccttgg
gttcaagatgcagatattatggctgaggtcatgggttcagatcattgccccgtatattta
gatttaaaagaagaatatgaaggaaaaaagttgtccaactttctaagtcactcaaaagaa
ccacctttactatcaacggcgcatcattcagcctatcggccatcaaaaaatattcattca
atgttccaacatttcaattcgatgaaaaagaataaaaacaactcacccactcagagcgaa
aacgtatctgcttctgcgtccagcggctcctcaccaactgtttctcgtgcaaactctgtc
atagacgtcgatgcctacccaccggaaaagagaagacgaaaagaacaatcgaagcttctt
tcattttttgcgaagcaaaaggaagagaaagaagaaaccaataaaacagaagacgtttcg
attgaggtccttgataacaataatgaatctgacatagggttgacagtaaaaaaaaaagta
gaaaacgggaacgcctggaagcaaatattcagtgaacgagctcctccactttgtgagggt
cacaaggaaccttgcaagtatttgacagtgaggaagccgggaatcaattacgggcggaag
ttttggatttgtgccagaccggttggtgaactgattaaaaactcaaatgcagtttctgag
gaagatactcaaccgttccaatgcaggttctttatctgggactcagattggagagcaaat
tcaaaggactga

DBGET integrated database retrieval system