KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3E7.01
Entry
SPBC3E7.01        CDS       T00076                                 

Gene name
fab1
Definition
(RefSeq) 1-phosphatidylinositol-3-phosphate 5-kinase Fab1
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00562  Inositol phosphate metabolism
spo01100  Metabolic pathways
spo04070  Phosphatidylinositol signaling system
spo04145  Phagosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SPBC3E7.01 (fab1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SPBC3E7.01 (fab1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    SPBC3E7.01 (fab1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC3E7.01 (fab1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     SPBC3E7.01 (fab1)
Membrane trafficking [BR:spo04131]
 Endocytosis
  Macropinocytosis
   Kinases
    SPBC3E7.01 (fab1)
 Endosome - Golgi transport
  Others
   Others
    SPBC3E7.01 (fab1)
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 FYVE FYVE_2
Other DBs
NCBI-GeneID: 2541154
NCBI-ProteinID: NP_596090
PomBase: SPBC3E7.01
UniProt: O59722
Position
II:complement(2653545..2659343)
AA seq 1932 aa
MSEVETPTAASPTFPVETSHRLDTLHTSSTEQIIKDSENVVHTTLKLPTSTLSREFWMKD
ERTNNCSLCETEFTLFRRKHHCRICGKIICKYCLKEAPGFIFRLQGSIKVCRPCASILVN
NYSRSQLFNHSLNESKNRDLTEQHPFVTLDELNSNDQVLSSFGDLSSTFEMPNNIHPPEV
APMIAIPSSRSNYDSPGWAHHSIFLDWSKRNLDSNVINVEDSESGKYNALTITNSYDAGP
SSVSTDYRPVNFGKVPSYSKLRKNKAFSSAKVSDMYLSADERNRLEDFSKGDRGLSFVNL
SPNIKATSYDRLSTVINEPFISRSSSLTDERGLADSGNSYHHFSDSDDESLFNDGLGLSF
HANSAIIKQRQQNVASIQRYGNESYLSNFLKAFLPKTVCDYLFPSSTIPDGLPALIENFN
ARVDKVNHPGGTEEPLPYQGKSRASSVVTSSKSTCILPPWILFSDSFNQLVCTFLGKLLF
QMLNDEGVDSPMQWVLCLPKILLKMALDLGPDIRSGDDIDVRSYVKIKKIPGGSIQDCFL
VNGVLFSKKASSKSMDRSLRRPRIALLTFSLDYACDEQRILSLDLIISQQEEYIINLVNR
ICMLKPNLVFAQGQIPSIALKYFEEHGVIAFHGLKESVLYDIARCCRADIISSIDKLSLC
PRLGTCGRFQLRTYVVDENKGLRKTFAILDRCSERLGCTIVLRGADYNQLSKVKKIVELV
VLIAYHIKLECALLRDKFVNMPELFETTYQSLSRKSLPSFASTAADKEKSQNHEKKSLNS
DNQSLRPLENENQSVSSTQGSNSPLELINNLPASDDYSSITKALKTRFLTFSPFLSKPLP
RLLNQVNYYQFIRNKLLKDVKLHPYSPTGSFVMKQSENDNVEESYEESYKFFCIDERYHF
LEKQWTLYYSHSKLMFSPFSSQRIILLYSIINKETSVPCIGPERCLLEFYRETDCTLGQY
IEDSCLNTNVSCGGEYCKTNDMLWHYRSYVHGNSRISVFLESFSCPVPGLEEKIIMWSYC
KFCKKNTHITVMSEETWKYSFGKYLEFMFYNSQIRDRFEFCDHSVMAQHVHYFGYCNMAL
RFQRDLIEIFELFVPSVTLRNNPSYIKELKEKEYKRLKGVIEKCLSSVASRINQIKCDWV
TDPEKFESCTSEISKFRTLLSSDYTELYSEFDSIYLNSSTSDYLSLNSILRVLQGKMVKW
EQRFLDYQRLYLPSYKELSKIAAAQIKKVFLERPLSQTPLDLPETLENTQIDIYPSFKTE
STDDQLEKVTQTNVASNKRVAPYADSMANVGSPESDCFSVATSSDIPKANIDFTNDISTQ
NTFPASPVSNSGFSRQTYPNISQRQGVNMLSHKRKSASTSDRRFVNASSTSGMNMPISSS
ISAKISSIQNSTKYSPRKPIPAKDVRVSSLVRRFEELSLQLQEKQKRDEELIKARRKRAL
PVVPSKPVVEVFNDLNEAFDDENSEDENGINDTKENRATESNFSGVDSMSKERENVSSNE
DNSPEAFEDIFGILFKNESGLEEQQNLEPSSQMDKEGSKLPTSGPLADKTSVYRILSAFW
NEWNSLNPPPFEFPLQPTEHMFSDSNVIIREDEPSSLISFTLSSPDYLSKMVEIEDSMDE
ALTNQGLQGSTQFKIENLMLKPTGTHLKYQFEEGSARLSCKVFFAEQFSALRRACGCEET
FVTSLARCSLWESSGGKSGSAFLKTFDKKYILKVLSRLESDSLLNFAPAYFDYISKVFFH
ELPTALTKIFGFYRVDIRNPTTGTICKTDIMIMENVFYDECPSRIFDLKGSMRNRHVEST
GKVDEVLLDENLVELIYESPIFVSEQLKSLLHSCLWNDTLFLSKLNIMDYSLIVGIDYTK
KELYVGIIDFIRTYTWDKKLESWVKEKGLVGRGPEPTIVTPKQYKNRFRKAMDCYILASQ
DFETGEGFKFCE
NT seq 5799 nt   +upstreamnt  +downstreamnt
atgtcagaagtcgaaacgcctaccgcagcctcgcccacttttcctgttgaaacctctcac
cgtttagatactttgcatacatcaagcacagagcaaatcattaaagattccgagaatgtt
gtccacactacgttgaaattgccgactagtacgttgtcgcgcgaattttggatgaaagat
gaaagaacaaacaactgttcattatgtgagacggaatttactttatttcgaaggaaacat
cattgtagaatatgtgggaaaattatctgcaaatattgcttaaaagaagctcctggattt
atctttcgtctccaaggatcgatcaaagtgtgtcgtccatgtgcttcaattttagttaat
aattattctcgaagccagctattcaatcattcattaaacgaatccaaaaatagagatctt
acggagcaacatccgtttgttacactggacgaacttaattcgaatgatcaagtactatca
tcatttggagatttaagtagcacatttgagatgcctaataatattcatcctcctgaagtt
gctccaatgatagctattccctctagtcgctcgaattatgattctcctggttgggctcac
cattccatctttcttgactggagcaaaaggaatttagattcgaatgttataaatgttgaa
gattccgaaagtggtaaatataatgctttaaccattacaaatagttacgatgctggtcct
agctctgtttccacagattatcgtcccgtcaattttggaaaagtaccttcatactcaaag
ttaagaaagaataaagcgttttcctcagcgaaagtctctgatatgtacttgtcggctgat
gaaagaaaccggctcgaggattttagcaaaggcgacagaggcctttcatttgttaacctt
tctccaaatataaaagcaacgtcttacgatcgattgagcacagtaataaatgaacccttt
atttcaagaagttcttccttgactgatgaacggggtttggccgattcgggcaattcctat
catcatttctccgactccgacgatgaatcactattcaatgatggattgggcctttctttt
catgccaatagtgcaattattaagcaacgccagcaaaatgttgcatcaattcagcgttac
ggtaatgaaagttacttatcaaattttttaaaagcttttcttccgaaaacggtttgcgac
tatctttttccttcttctactattcccgatggacttcccgctttaattgaaaacttcaat
gcgcgagttgataaggtgaatcatcccggtggaacagaagagcctcttccttaccaggga
aagtcgcgtgcttcttctgtagttacctcttccaaaagcacatgtattttaccaccttgg
attctcttctctgattcatttaatcagcttgtatgtacttttctgggaaaattactcttt
caaatgctaaatgatgagggtgtggattcgcctatgcaatgggtactttgtctcccaaaa
attcttttaaaaatggctttggatctaggtcctgatattcgctctggtgatgatattgat
gtccgcagctatgtaaaaataaaaaagattcccgggggaagcattcaagattgttttctt
gttaatggtgttttgttctcaaaaaaagcttcgtccaaatctatggaccgctcgcttcgt
cggcctcgtatagctcttttaactttcagtttagactacgcttgtgacgaacagagaatt
ttatccttggatttaatcatctctcagcaagaagagtatattataaatcttgtcaataga
atctgcatgcttaaaccgaatctagtttttgctcagggtcaaatccccagtattgccttg
aagtactttgaagaacatggcgttatagcctttcatggacttaaagaatcagttttatat
gacatagctagatgttgtcgtgcagacataatatcgtcaatagataaattgtcgctttgt
cctcgtcttggtacttgcggcaggtttcaactcagaacgtatgttgtcgatgaaaacaaa
gggttgaggaaaacgtttgctatacttgatcgctgctcggaacgtttaggctgcaccata
gttctaagaggagctgattataatcagttgagcaaggtcaagaagattgtcgaacttgtt
gttttgattgcatatcatatcaaacttgaatgtgccttgttaagagacaaatttgtgaat
atgccggagctttttgaaacaacctatcaaagtttgtctaggaaatcgttgccttcgttt
gcctctactgcagctgataaagagaaaagccaaaatcatgaaaaaaaatctctgaacagt
gataatcaaagtttgcgacctttggaaaatgaaaatcaaagtgtttctagcacccaaggt
agcaacagcccgcttgagttgatcaataacttaccagcctcagatgactattcttctatt
accaaggctttgaaaaccagatttttaacgttttcaccctttttatcaaagcctcttcca
cgtttattaaaccaagttaattattaccagtttattcgtaacaaattactgaaagatgtg
aagttacatccatactcaccaactggctcattcgtaatgaagcagtccgaaaatgacaat
gtagaagaaagttacgaagagtcctataaattcttttgtattgatgaacgttatcatttt
ttagaaaagcagtggacactttattactctcattcaaaactcatgttttctccattttct
tctcaaaggattattttgttatattccattattaacaaggaaacttctgttccttgtatt
ggccctgaacgttgtctattagaattttatcgagaaactgattgcactcttggtcagtac
atagaggactcatgcttgaataccaatgtaagttgtggaggtgagtattgtaaaacgaat
gatatgctgtggcattacaggagttatgttcatggaaatagtcggatcagcgtttttttg
gaatctttttcgtgccctgtccctggtttggaagaaaagataattatgtggagttactgc
aaattctgtaaaaagaatacacacattactgttatgtctgaagaaacatggaaatattcg
tttggaaaatatcttgaattcatgttctataattctcaaataagggatcgcttcgaattc
tgtgaccacagtgttatggcacaacatgttcattatttcggttattgcaacatggcttta
cgatttcaaagagacctaatagagatttttgaactcttcgttccatcggtcactttacga
aataatccatcatatattaaagagctgaaagaaaaggagtataaacgtttaaaaggtgtc
attgaaaaatgcttgtcttctgttgcttcaaggataaaccaaataaagtgcgattgggtt
actgatcctgagaaatttgagtcttgtacatctgaaatttcaaaatttcgcactttactt
tcaagtgactatactgaattgtattctgaatttgattcaatttatcttaattcctcaact
tctgattatttatcactaaactcaatcctgcgcgtcctccagggtaaaatggtaaaatgg
gaacagcgctttcttgactatcaacggctgtatcttccatcttacaaagagttaagtaaa
atagcagccgctcaaattaagaaagtgtttctggaacgtccattaagccaaaccccttta
gatttgccagagacacttgagaatactcaaattgatatatatccctcctttaaaactgaa
tccactgatgatcaactcgagaaagttacccaaactaatgttgcttcaaacaagcgtgtt
gctccgtatgcagatagtatggcaaatgttggttctccagaatctgattgcttttcagta
gcaacatcttccgatattcctaaagccaacatcgattttaccaatgatatttctactcag
aacacttttccagcttctccggtctcaaattcaggtttcagtagacaaacgtatccaaat
ataagccaaagacaaggcgttaatatgctttctcataagcggaaaagtgctagtaccagt
gacaggcgatttgtcaatgcatcttcaacaagtgggatgaacatgcctatttcttcttca
atatctgcaaaaatttccagtatacagaattctacaaaatactcacccaggaagcccatt
ccagcaaaagatgtgcgggttagctctttagtgcgtagatttgaagagctaagtttacaa
ttacaagaaaagcaaaaacgagatgaagaattaataaaggctcgacgcaagcgggctctt
cctgtagtcccatctaagccggtagtagaagtatttaatgaccttaatgaagcatttgat
gatgaaaattccgaagatgagaatggcattaatgacacaaaagaaaatcgcgctaccgaa
agcaatttttctggagttgattctatgagcaaggagcgagaaaatgtttcttcgaatgaa
gacaattcacctgaagcgtttgaagatatttttggaattcttttcaaaaatgaatctggc
ctcgaagaacagcaaaaccttgaaccttctagtcaaatggataaagagggatcaaagttg
ccaacttctggtcctttggctgacaaaacttcagtttacaggattttatctgcattttgg
aatgaatggaactccctcaatcctccaccttttgaatttcctctacaacctacagagcat
atgttttccgactcaaatgtgatcataagggaagacgaacctagctccttgataagtttt
actcttagctctcctgactatttatcaaaaatggtagaaattgaagatagcatggacgaa
gctttaaccaatcaaggcttacaaggctcgacgcaattcaaaattgaaaacttaatgctc
aaaccaacggggacgcatttgaaataccagtttgaagaaggatcagcaagactatcctgt
aaggtctttttcgcggaacaatttagtgctttgcgaagagcttgtggctgtgaggagacg
tttgtgacatctctagcgagatgttctctttgggaatctagcggtggaaaatctggatca
gcatttttaaaaactttcgataagaaatacattctcaaagttctgtcaaggttggaaagt
gactccttgcttaattttgctccagcttattttgattacatatctaaagttttctttcac
gagttgccaactgcattgactaaaatctttggattttaccgcgtagacattcgaaatcct
actactggtacaatctgtaagactgatataatgattatggaaaatgtattttatgatgaa
tgtccgtctagaatatttgatcttaaaggttccatgaggaatcgacatgtagaatctaca
gggaaggtagatgaagtattgcttgatgaaaatttggttgaacttatttacgaatctcca
atatttgttagtgaacaactaaaaagtcttttgcattcttgcctttggaatgatacattg
ttcctctcaaaactcaatatcatggattactctttaattgttggtattgattatacaaaa
aaagaactttatgttggaataattgatttcatacgaacatacacttgggacaaaaaactt
gaaagttgggtaaaggagaaaggcttagttggtagaggtcctgaaccaacaattgttact
ccaaagcaatacaaaaatagattccgaaaggctatggattgctatattttagcatctcag
gattttgagactggggaaggttttaagttttgcgaatag

DBGET integrated database retrieval system