KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3E7.02c
Entry
SPBC3E7.02c       CDS       T00076                                 

Gene name
hsp16
Definition
(RefSeq) heat shock protein Hsp16
  KO
K13993  HSP20 family protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC3E7.02c (hsp16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPBC3E7.02c (hsp16)
Chaperones and folding catalysts [BR:spo03110]
 Heat shock proteins
  HSP20
   SPBC3E7.02c (hsp16)
SSDB
Motif
Pfam: HSP20 ArsA_HSP20 CS DUF4097 PIH1_CS VLPT
Other DBs
NCBI-GeneID: 2540977
NCBI-ProteinID: NP_596091
PomBase: SPBC3E7.02c
UniProt: O14368
Structure
PDB: 
3W1Z

Position
II:complement(2660490..2660921)
AA seq 143 aa
MSLQPFFGFPPTVNDLFSDFVSYSPRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKE
DVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFS
NGLLTVTLPKVEKSQTKKQIAIK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtctttgcaaccttttttcggctttccccctactgtcaacgacttgttctctgacttt
gttagttactcccctcgtttgaacaaccaaattcctggggagttgtctccttcgattgat
gtgcatgagggtaaagacactgttagcgttgatgtagaactccctggtgttaagaaagag
gacgttcaagtccattatgatagcggaaaacttactatttctggcgaagtcgtcaatgag
agaaagaatgaaagcaccgagggtaaccaacgctggtcagagcgtcgctttggctcattc
tctcgtaccattactattccagccaagattgatgcagatcgcattgaggccaacttcagt
aatggcctattgactgtcaccttgcccaaggtcgagaagtcccaaactaagaaacaaatt
gctattaagtaa

DBGET integrated database retrieval system