KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3E7.06c
Entry
SPBC3E7.06c       CDS       T00076                                 

Gene name
fnx2
Definition
(RefSeq) vacuolar membrane amino acid uptake transporter Fnx2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like
Other DBs
NCBI-GeneID: 2541016
NCBI-ProteinID: NP_596093
PomBase: SPBC3E7.06c
UniProt: O59726
Position
II:complement(2668207..2669940)
AA seq 577 aa
MSNPRTKSPNTNRGQGLRSERSALLNDSLSSLNGNSSYDSIKDSSKNNKDVAEVNEYPRR
PESSVSVVSNSPHRQDAATTNTVSTVSVSKVLPALLLGVVLAALDNTIVASTYTKIGAEF
GKFSQVSWTATAYMISCTAFQPLFGKFCDIYGRKKTLLAAYCVFGIGCFLCGTSRSLWQL
VAARAIAGIGGGGMNSTVSILMSDIVPLKQRGTYQGIINVFFAIGSSLGGPVGGYFADQY
TWRIGFLIQVPLIAIAFLCVYFTLNLPHHNHVSFMTRFRKIDLKGLILLIIGVTTMTCAF
TLGGNVREWNDPVVISLLIASSISYLSFVYVEAFVAFEPLAPMDVLTERTCLSSYLCNFF
HSVANFGWIYGMPLFFQSIKNEGAEKSGIRLIPMIIGSSLGSLLGGAVISLTGNYKKITV
GSYFFGSVAALFMLRYGYSNFNWEYAVYPFSGGLGNGIAVTTTLVAIIHASPSAFQASAI
ATSYLFRSNGCVLGVSISSSIVQTVLGIKLRKSLDFDVDELLHHLRKDISYVHRLPEEIR
QTVLDALLGSIHYSFLFVSFMFFCAFVCSMFIKNRNL
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgtcgaacccaagaaccaaatctcctaatacaaacagaggtcaaggattacgttcagag
cgctcagctctcttgaatgactctctgtcttcattaaatggaaactcatcatatgactct
atcaaagattcttccaaaaacaacaaggatgttgctgaagtgaacgagtaccctcgtagg
ccagaatcttcagtgtctgtagttagcaattcgcctcatcgccaggatgcagcgacgact
aatactgtgtctacagtttctgtttccaaagttcttccggcgttattgttgggtgttgtt
ttggctgctttagacaataccattgtcgcctctacgtatacgaaaattggtgccgaattt
ggaaagtttagtcaagtttcatggaccgctacagcatacatgatatcttgcactgcgttc
caaccattgttcggaaaattttgcgatatctatgggaggaaaaagactcttctggcggct
tactgtgtatttggaataggctgcttcctttgtggtacttctcgctctttatggcagcta
gtagcagctcgagctattgctggaattggtggaggaggcatgaattcgactgtaagcatt
ttaatgagcgatatcgtgcctttaaaacaaagaggaacttaccaaggaattataaatgta
ttttttgctatcggttcaagccttggcggaccagtgggtggttactttgccgatcaatat
acttggagaattggttttttaattcaggttcccttaattgctatcgcctttttgtgtgtt
tactttactcttaatcttccccatcacaaccacgtaagtttcatgaccagatttcggaaa
attgatttgaaaggtctgatcttgctaattattggtgtcacaacgatgacttgtgctttt
accttaggtggaaatgttagagaatggaatgatcctgttgttatttctttgctgatcgct
tcttctatttcatatctttcatttgtttacgtagaagcgtttgtggcttttgagccgctg
gcgccaatggatgttcttactgagagaacctgcctttcatcatatctttgcaatttcttt
cactccgttgctaactttggctggatttatggaatgccgcttttttttcaatccataaaa
aatgaaggtgctgagaaatctggcattagactgataccaatgattattggcagcagtttg
ggttcgcttcttggaggtgcggtaattagtcttaccggaaattacaagaaaataaccgtt
ggtagttattttttcggtagtgttgctgcccttttcatgcttcgttatggctactcgaac
tttaactgggaatatgctgtttatcccttttccggtggtttaggaaacggcattgctgtt
actactactttagtcgccataattcatgcttctccgtcagcatttcaagcttctgctatt
gctacttcatatttgtttaggtccaatggttgtgtcctaggcgtttccatatcatcctca
atcgtgcaaactgttttaggaattaaactgagaaaatcattagattttgacgttgatgaa
ttgcttcatcacttacgtaaagatatttcttatgttcatcgtttacctgaagaaattcgc
caaacagtactggatgcacttttgggtagcattcactattcgtttttgtttgtctcattc
atgtttttctgcgcatttgtttgctcaatgtttatcaaaaatcgtaacctctag

DBGET integrated database retrieval system