KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3E7.07cHelp
Entry
SPBC3E7.07c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt_4
Motif
Other DBs
NCBI-GeneID: 2541002
NCBI-ProteinID: NP_596094
PomBase: SPBC3E7.07c
UniProt: O59727
Position
II:complement(join(2671959..2672035,2672174..2672397,2672453..2672507,2672551..2672578,2672640..2672651,2672697..2672744))
Genome map
AA seq 147 aa AA seqDB search
MLSTKIDAENAENAAEIEMQFAVKAVEQAQIYWSLLEMRKGSELKLTKYDDEIFEDLINT
FPEFKDPKTASFVNEDEMKSAKGKAAWRPFLMRYEKKVDDYNFGTLLRIKNTDEYEQETT
IFVPRMQFLAYEIARNRYGLNDWIKKD
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtacaaaaattgatgcggaaaatgcggaaaatgccgccgagattgaaatgcag
tttgcagtaaaagctgttgaacaggctcaaatatactggagtcttttggaaatgcgcaag
ggaagcgagttaaagctgacaaaatacgatgatgagatttttgaagatttaataaacacc
ttccccgagtttaaagaccctaaaacagcttcttttgttaatgaggatgaaatgaagtcc
gccaaaggaaaagctgcctggcgtccatttttaatgcgctatgaaaagaaggttgacgat
tacaattttggtactcttcttcgtattaagaatactgatgagtatgagcaagaaacgact
atttttgtccctcgtatgcaatttttggcctacgaaatcgcccgtaatagatacggtttg
aacgattggattaaaaaagattag

DBGET integrated database retrieval system