KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3E7.08c
Entry
SPBC3E7.08c       CDS       T00076                                 
Symbol
rad13
Name
(RefSeq) DNA repair nuclease Rad13
  KO
K10846  DNA excision repair protein ERCC-5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC3E7.08c (rad13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC3E7.08c (rad13)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     SPBC3E7.08c (rad13)
SSDB
Motif
Pfam: XPG_N XPG_I DUF2229
Other DBs
NCBI-GeneID: 2541051
NCBI-ProteinID: NP_596095
PomBase: SPBC3E7.08c
Ensembl: SPBC3E7.08c
UniProt: P28706
Position
II:complement(2672990..2676799)
AA seq 1112 aa
MGVSGLWDILEPVKRPVKLETLVNKRLAIDASIWIYQFLKAVRDKEGNQLKSSHVVGFFR
RICKLLFFGIKPVFVFDGGAPSLKRQTIQKRQARRLDREENATVTANKLLALQMRHQAML
LEENNKKATALANASVQNERQMPSSMTLDNSEIKPVLNQRKNYLKPDPYQLPEMDVSFDK
LGSSYDPRIMSQDELTQYVSSFTKIEDINLFDFSNIDFDSELFQSLPDTDKYSILSAARL
RSRLRMGLSSEQLSEMFPNRMDFSRFQIERLKERNDLTQRLMDFTGMNEFGPSRVVSEKN
REYILVKNEGAEGGWALGVISGSTNNEPIIIDDEATKLSSNLIDEDEDEAFYDVPLPSRS
HSMNPRELVAAKLKEIKENSFSENQQSDEADYNVTDDLILQLATQQSLEENKKSKELFSL
SASEFDKLNSEKKTFEILSTDIPAEDSMNSLLNDEENLKLEHVGDVSNDSLAFAEKKHPE
NGTSIFMDALPSASREKKTNDLIDPLPFQPMDWGKSIFFEKLKKPTETFMDSKTDIPSEA
PDNSKLVEDTNLHTINATVNIESDLDAAKPGIENPIISPLLPVKDDEKDLDLRELNPLEP
FENMKEQADDGTVTNPLNVSSDKAMSVYLLSSENAKDTGDIKSESIDAVLPTLETSSPSL
SIPTDFQKEASPNKGAAALSSKVEPEVVEKLLDEEEEEMIIRMAEEEKEYDRFVSELNQR
HETEEWNQEAFEKRLKELKNQKRSEKRDADEVTQVMIKECQELLRLFGLPYIVAPQEAEA
QCSKLLELKLVDGIVTDDSDVFLFGGTRVYRNMFNQNKFVELYLMDDMKREFNVNQMDLI
KLAHLLGSDYTMGLSRVGPVLALEILHEFPGDTGLFEFKKWFQRLSTGHASKNDVNTPVK
KRINKLVGKIILPSEFPNPLVDEAYLHPAVDDSKQSFQWGIPDLDELRQFLMATVGWSKQ
RTNEVLLPVIQDMHKKQFVGTQSNLTQFFEGGNTNVYAPRVAYHFKSKRLENALSSFKNQ
ISNQSPMSEEIQADADAFGESKGSDELQSRILRRKKMMASKNSSDSDSDSEDNFLASLTP
KTNSSSISIENLPRKTKLSTSLLKKPSKRRRK
NT seq 3339 nt   +upstreamnt  +downstreamnt
atgggggtttcaggtctttgggatattttagaaccggtaaaaaggcctgtcaagctagaa
acacttgttaacaaacggttggcaattgacgcttcaatttggatttatcaattcttaaag
gccgtacgtgacaaagaaggaaaccagctgaaaagcagtcatgttgtaggattttttaga
aggatatgcaaactattattttttgggattaaacctgtatttgtttttgatggaggagcg
ccgtcattgaaacgccaaactatccaaaaaagacaagccagaagactcgacagggaggaa
aatgccacggtcacggccaataaacttctggctttgcaaatgaggcatcaggcaatgctt
ttagaggaaaataataaaaaagctactgcattggcaaatgcctcggttcaaaatgagaga
caaatgccttcatctatgacattggataattcagaaattaagccagtacttaatcaaaga
aaaaattatttgaagcctgatccataccaactacctgaaatggacgtttcgtttgataag
ttagggtcgagttacgaccctcgaattatgtcccaggatgagcttacacaatatgtctct
agttttactaaaattgaagatataaatttatttgatttttcaaatattgattttgactct
gaattatttcaatcattacccgatacggataaatatagtattttaagtgcagcaagatta
cgctctcgtttacgaatgggtttaagctctgaacaactttccgagatgtttcctaataga
atggatttctctcgttttcaaattgagagactgaaggaacgtaacgatttaactcagaga
ttaatggactttactggaatgaatgagtttggaccctctagagtagtaagtgaaaaaaac
cgagaatatattttagtaaaaaacgaaggtgctgaaggtggatgggctctcggtgttatc
tcaggatctacaaacaatgaacctattattattgatgatgaggctacaaaacttagcagc
aatcttatagacgaagacgaggatgaggcattctacgatgtgcctttacctagccgatct
catagcatgaaccctagagaattggtagccgctaaattaaaggaaataaaagaaaattca
ttttcggaaaatcagcaatcagatgaagcagattataatgttactgatgatttaatactt
caattagcaacccagcaatctctagaggaaaacaaaaaatcaaaagagctgtttagtctt
tcggcttctgagtttgataagttgaatagcgagaaaaagacgtttgaaattttgtcgacc
gatattcctgcagaggattcaatgaattcacttcttaacgacgaggaaaatttgaaactt
gaacatgttggagatgtttccaatgattcattagcattcgcggaaaaaaagcatcctgaa
aatgggacttcaatttttatggatgcccttccatctgcgagtagagagaaaaaaaccaat
gatttaattgatcctttaccttttcagcctatggattggggaaagtctatttttttcgag
aaattaaagaaaccaactgaaacatttatggattctaaaactgatataccaagtgaggca
ccggataattctaaacttgtggaagatacaaatttacatactattaatgcaacagttaat
attgaatccgatttagacgctgctaaacctggaattgaaaatccaattatttcacctctt
cttccggtaaaagatgatgaaaaagatttagacttacgtgaactcaatcctttggaaccc
tttgagaatatgaaagaacaagctgatgatggcacagttaccaacccattaaatgtttct
agtgataaggccatgtcagtgtatttattgagctccgaaaatgctaaggatactggggat
atcaaatccgaatcaattgacgctgttcttcctactttagagaccagcagcccttcactt
agcattccaactgactttcaaaaagaagcctctccaaataaaggagctgctgccttgagt
tcgaaagtagagcctgaagtggttgaaaaacttttagatgaggaagaagaggaaatgatt
atcaggatggcagaagaagaaaaggaatatgatcggtttgtttcagaactcaatcaacga
catgaaactgaagagtggaatcaagaggcctttgaaaaaaggttgaaagagctcaaaaat
caaaaaaggtctgaaaaacgtgatgcggatgaggtcactcaagtaatgattaaagaatgt
caagaacttctgcgtttatttggcttaccatatatcgttgctcctcaagaagcagaagcc
cagtgttctaaacttttggagctaaagctggttgatgggattgttactgatgactcagac
gtgtttctttttggtggaactcgggtatatcgaaatatgtttaatcagaacaaatttgtc
gaactctatttaatggatgatatgaaaagagaatttaatgtgaatcaaatggatttaatt
aagttggcacatcttttgggaagtgattatactatgggactttctagggtaggtccagtt
cttgcactggagattttacatgaatttcctggtgacactggactttttgaatttaaaaaa
tggtttcaacgtttatcaactggacacgcatcaaaaaatgatgttaatacgccagtaaaa
aagagaattaacaagttggttggaaaaattattttaccatcagaatttcctaatccgtta
gttgatgaagcttatcttcatccggccgtggatgatagcaagcaatcgtttcaatggggc
atacccgaccttgacgagttacgccagtttttgatggctactgtgggttggtcaaaacaa
cgaactaatgaagttttacttccggttatacaagacatgcataaaaagcaattcgtgggt
acacagtccaatttgactcagttttttgaaggtggtaatactaatgtatatgcgccgaga
gttgcataccattttaagagtaaacggcttgaaaatgctctttcatcttttaaaaatcag
attagcaatcaaagcccaatgagtgaagaaattcaggcagacgcagatgcatttggtgaa
tctaaaggatcagatgaactacaaagccgtattcttagaaggaagaaaatgatggcaagc
aaaaattcctctgattcagattcagactctgaagataactttttagcaagtttaactccg
aagacgaattcttcttcaatttctattgagaatctacctagaaaaaccaagcttagtact
agcttactaaaaaaacccagcaaaagaagaagaaaataa

DBGET integrated database retrieval system