KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3E7.10
Entry
SPBC3E7.10        CDS       T00076                                 

Gene name
fma1
Definition
(RefSeq) putative methionine aminopeptidase Fma1
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spo01002]
    SPBC3E7.10 (fma1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     SPBC3E7.10 (fma1)
Peptidases and inhibitors [BR:spo01002]
 Metallo peptidases
  Family M24
   SPBC3E7.10 (fma1)
SSDB
Motif
Pfam: Peptidase_M24 zf-C6H2 zf-MYND
Other DBs
NCBI-GeneID: 2540928
NCBI-ProteinID: NP_596097
PomBase: SPBC3E7.10
UniProt: O59730
Position
II:join(2678873..2678989,2679042..2679062,2679112..2679157,2679218..2680173)
AA seq 379 aa
MATEIAKHICCGIDCNNEADRLQCPKCLNDGVKSYFCGQECFRNSWNIHKHLHRPPNVEK
REDGTYNPFPKFHFAGSLKPVYPLSPIRKVPPHIKRPDYAKTGVSRSEQIEGRSFKLKRL
TPKEQEGMRKVCRLGREVLDAAAAAVRPGTTTDELDSIVHNACIERDCFPSTLNYYAFPK
SVCTSVNEIICHGIPDQRPLEDGDIVNIDVSLYHNGFHGDLNETYYVGDKAKANPDLVCL
VENTRIALDKAIAAVKPGVLFQEFGNIIEKHTNSITEKQISVVRTYCGHGINQLFHCSPS
IPHYSHNKAPGIARPGMTFTIEPMLTLGPARDITWPDDWTSSTASGRCSAQFEHTLLVTE
TGCEVLTARLPNSPGGPLK
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggctactgaaattgcaaaacatatttgttgcggtatagattgtaataatgaagctgac
agactgcaatgtcccaaatgtctaaatgacggagttaaatcttacttttgtggacaggaa
tgcttcaggaacagctggaatattcacaaacatcttcatcgtccaccgaatgtagaaaag
agagaggatggaacttacaatcctttcccaaaatttcatttcgcaggttcattgaaacca
gtttatccgctttcgcctatacgcaaggttcctccacatataaaaagacctgactatgcg
aagacaggagtctctcgtagcgagcaaattgaaggtcgaagcttcaaactgaagagattg
acacccaaggagcaggaaggtatgcgtaaagtatgtagacttggtagagaggtacttgat
gctgccgctgctgccgtccgtcctggaacaactaccgatgaacttgatagtattgttcat
aatgcatgcattgaacgtgattgttttccaagcacccttaactattacgcgttcccaaaa
agtgtttgtacttctgtgaacgaaatcatctgtcacggaattccagatcaaaggccactt
gaggatggtgatattgtaaacattgatgtttccctttaccataacggttttcatggtgac
ctaaatgagacttactatgttggagataaagcaaaagcaaatcctgacctcgtttgcctt
gtagaaaatacgagaattgctttggataaagcaattgctgcggtaaaaccgggagtattg
tttcaggaattcggaaatattattgaaaagcatacaaatagcattactgagaagcagatt
tctgtcgtccgcacatattgtggacatggaatcaaccagttatttcactgttctcctagt
attcctcattattcccacaacaaggcacctggaattgctcgcccaggaatgacttttaca
atcgaacctatgcttactctaggtcccgcccgagacattacctggccggatgattggact
agttcaactgcatctggacgctgttctgctcaattcgaacatacactgttagttacagag
actggttgtgaagttttaacagccagactccccaattcacctggagggcccttaaaataa

DBGET integrated database retrieval system