KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3E7.15c
Entry
SPBC3E7.15c       CDS       T00076                                 

Gene name
lac1
Definition
(RefSeq) sphingosine N-acyltransferase Lac1
  KO
K04709  very-long-chain ceramide synthase [EC:2.3.1.297]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00600  Sphingolipid metabolism
spo01100  Metabolic pathways
Module
spo_M00094  Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SPBC3E7.15c (lac1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.297  very-long-chain ceramide synthase
     SPBC3E7.15c (lac1)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Other DBs
NCBI-GeneID: 2540466
NCBI-ProteinID: NP_596102
PomBase: SPBC3E7.15c
UniProt: O59735
Position
II:complement(join(2686630..2687736,2687918..2687965))
AA seq 384 aa
MGNNTSRRSQSQKFKNIPSISAGSFSTMPVQHRGRRRRSKSIVGRAAQNAVLRSKEKTWI
VPLILLTLLVGWYFVNPNGYIKYGIFLSYPIPGTNPAQYGKGRLDIAFCLFYALFFTFCR
EFIMQEIIARIGRHFNIRAPAKLRRFEEQAYTCLYFTVMGSWGLYVMKQTPMWFFNTDAF
WEEYPHFYHVGSFKAFYLIEAAYWIQQALVLILQLEKPRKDFKELVVHHIITLLLIGLSY
YFHFTWIGLAVFITMDTSDIWLALSKCLNYVNTVIVYPIFVIFVFVWIYMRHYLNFKIMW
AVWGTMRTINSFDLDWAAEQYKCWISRDVTLILLTALQLVNIYWLILILRIGYRAFTTND
THDERSEDEDEEVSDEKSSAKKND
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgggtaataatacctcgagaagaagtcaatctcaaaaattcaaaaacattccaagcatt
tctgctgggtcgttttcgacgatgccagtccagcatagaggacgacgaagaaggtcgaag
tctatcgttggtcgtgctgctcaaaatgctgtccttcgtagtaaagagaaaacgtggatt
gtacctctcattctcttaactttgctcgtcggctggtattttgttaatcctaatggttat
attaagtatggaattttccttagttatcctatccccggtaccaaccccgctcagtatggt
aaaggacgtttagacattgccttttgtcttttttacgctttattctttactttttgtaga
gaattcataatgcaggaaattattgcgagaattggcagacactttaatattagagctcct
gcaaagcttcgtcgctttgaagagcaagcttatacttgtctatactttactgtaatgggt
tcttggggattgtatgttatgaaacaaactcctatgtggttttttaatacagatgctttt
tgggaggaataccctcatttttaccatgttggcagctttaaagcattttatttaatagaa
gcagcctattggatccaacaagcactcgtactaattttacaacttgagaagcctagaaag
gattttaaagagctcgtggtacaccatattatcaccctgcttttgatcggactcagctat
tatttccattttacttggattggtttggctgtttttattacgatggacacctctgatatt
tggcttgctttatccaaatgcttgaattatgtaaacactgtaatagtttaccctattttc
gttattttcgttttcgtatggatctacatgcgacattacctaaactttaagattatgtgg
gcagtttggggaaccatgcgtactattaactcatttgacctagattgggctgcagagcaa
tacaagtgctggatttcgcgcgacgtaacacttatcctgctcacagcgttacaactagta
aacatttactggcttattttgattcttcgaattggttacagagcttttacaacgaacgat
actcatgacgaacgtagtgaggatgaggacgaagaagtttccgatgaaaaatcgtccgct
aaaaagaatgattag

DBGET integrated database retrieval system