KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3H7.08c
Entry
SPBC3H7.08c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Other DBs
NCBI-GeneID: 2541007
NCBI-ProteinID: NP_595767
PomBase: SPBC3H7.08c
UniProt: O74383
Position
II:join(1869252..1869320,1869390..1869441,1869602..1869843)
AA seq 120 aa
MSIMRSIMSNRLVRWSREYPELFITWCVMTYTFGVAGYMLGQRGLLVQHEDQVRIPSKNA
HPWEDTKSSSGKSDESLDYSYKYYPRGDRSKEPRKAPSAIQYSTFPVKGVSEEVLERFSK
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtcaattatgcgctcaattatgtcgaaccgcctggttcgctggtcaagagaatatcca
gaactatttataacttggtgtgtcatgacttatacctttggagttgctggttatatgctt
ggacagcggggcttgttggtacaacatgaagatcaagtccgaattccttcaaaaaatgct
cacccctgggaagacaccaaaagcagtagcggaaaaagtgatgagagtcttgattatagc
tacaagtattatcctcgaggagataggagtaaagaacctcgaaaggcaccttctgctatt
caatacagcacttttcccgttaaaggtgtatcagaagaggtacttgagcgattctctaag
taa

DBGET integrated database retrieval system