KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3H7.15
Entry
SPBC3H7.15        CDS       T00076                                 

Gene name
hhp1
Definition
(RefSeq) serine/threonine protein kinase Hhp1
  KO
K14758  casein kinase I homolog HRR25 [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    SPBC3H7.15 (hhp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPBC3H7.15 (hhp1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC3H7.15 (hhp1)
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPBC3H7.15 (hhp1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPBC3H7.15 (hhp1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   SPBC3H7.15 (hhp1)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-40S particles
   Kinases
    SPBC3H7.15 (hhp1)
  Pre-60S particles
    SPBC3H7.15 (hhp1)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  tRNA modification factors
   Elongator related proteins
    SPBC3H7.15 (hhp1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH
Other DBs
NCBI-GeneID: 2540718
NCBI-ProteinID: NP_595760
PomBase: SPBC3H7.15
UniProt: P40235
Position
II:complement(join(1855589..1855795,1855918..1856808))
AA seq 365 aa
MALDLRIGNKYRIGRKIGSGSFGDIYLGTNVVSGEEVAIKLESTRAKHPQLEYEYRVYRI
LSGGVGIPFVRWFGVECDYNAMVMDLLGPSLEDLFNFCNRKFSLKTVLLLADQLISRIEF
IHSKSFLHRDIKPDNFLMGIGKRGNQVNIIDFGLAKKYRDHKTHLHIPYRENKNLTGTAR
YASINTHLGIEQSRRDDLESLGYVLVYFCRGSLPWQGLKATTKKQKYEKIMEKKISTPTE
VLCRGFPQEFSIYLNYTRSLRFDDKPDYAYLRKLFRDLFCRQSYEFDYMFDWTLKRKTQQ
DQQHQQQLQQQLSATPQAINPPPERSSFRNYQKQNFDEKGGDINTTVPVINDPSATGAQY
INRPN
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggctttggacctccggattgggaacaagtatcgcattggtcgtaaaattggcagtgga
tctttcggagacatttatcttgggactaatgtcgtttctggtgaagaggtcgctatcaag
ctagaatcaactcgtgctaaacaccctcaattggagtatgaatacagagtttatcgcatt
ttgtcaggaggggtcggaatcccgtttgttcgttggttcggtgtagaatgtgattacaac
gctatggtgatggatttattgggtccttcgttggaagacttgtttaatttttgcaatcga
aagttttctttgaaaacagttcttctccttgcggaccagctcatttctcgaattgaattc
attcattcaaaatcttttcttcatcgtgatattaagcctgataactttttaatgggaata
ggtaaaagaggaaatcaagttaacataattgatttcggattggctaagaagtatcgtgat
cacaaaactcacctgcacattccttatcgcgagaacaagaatcttacaggtactgcacgc
tatgctagcatcaatactcatttaggtattgaacaatcccgccgtgatgacctcgaatct
ttaggttatgtgctcgtctacttttgtcgtggtagcctgccttggcagggattgaaggct
accacgaaaaagcaaaagtatgaaaagattatggagaagaagatctctacgcctacagag
gtcttatgtcggggattccctcaggagttctcaatttatctcaattacacgagatcttta
cgtttcgatgacaaacctgattacgcctaccttcgcaagcttttccgagatcttttttgt
cggcaatcttatgagtttgactatatgtttgattggaccttgaagagaaagactcaacaa
gaccaacaacatcagcagcaattacagcaacaactgtctgcaactcctcaagctattaat
ccgccgccagagaggtcttcatttagaaattatcaaaaacaaaactttgatgaaaaaggc
ggagacattaatacaaccgttcctgttataaatgatccatctgcaaccggagctcaatat
atcaacagacctaattga

DBGET integrated database retrieval system