KEGG   Schizosaccharomyces pombe (fission yeast): SPBC4.04cHelp
Entry
SPBC4.04c         CDS       T00076                                 

Gene name
mcm2
Definition
(RefSeq) MCM complex subunit Mcm2
  KO
K02540  DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo04111  Cell cycle - yeast
spo04113  Meiosis - yeast
Module
spo_M00285  MCM complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC4.04c (mcm2)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPBC4.04c (mcm2)
   04113 Meiosis - yeast
    SPBC4.04c (mcm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC4.04c (mcm2)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC4.04c (mcm2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPBC4.04c (mcm2)
DNA replication proteins [BR:spo03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    SPBC4.04c (mcm2)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    SPBC4.04c (mcm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCM MCM2_N MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3 Sigma54_activat AAA SelR AAA_30
Motif
Other DBs
NCBI-GeneID: 2540620
NCBI-ProteinID: NP_595477
PomBase: SPBC4.04c
UniProt: P40377
Position
II:complement(join(1191397..1193656,1193876..1194108))
Genome map
AA seq 830 aa AA seqDB search
MDSFRKRGRRDSESLPFESENSSLGATPLSLPPSSPPPEFSDEAAEALVEEDIEDLDGEA
LDVEDEEGEDLFGEGMERDYQQNLELDRYDIEELDDDNDLEELDIGARRAVDARLRRRDI
ELDAAAGRTKPAAFLQDEDDDLDSNLGTGFTRHRHRIYDEYSPNVGALDESGELPLESIA
DVKADSIAEWVTLDPVRRTIAREFKNFLLEYTDENGTSVYGNRIRTLGEVNAESLMVNYA
HLGESKPILAYFLANAPAPIFRIFDRVALEATLLHYPDYERIHSDIHVRITNLPTCFTLR
DLRQSHLNCLVRVSGVVTRRTGLFPQLKYIRFTCTKCGATLGPFFQDSSVEVKISFCHNC
SSRGPFVINSERTVYNNYQRITLQESPGTVPSGRLPRHREVILLADLVDVAKPGEEIDVT
GIYRNNFDASLNTKNGFPVFATIIEANHISQLDGSGNTDDDFSLSRLTDDEEREIRALAK
SPDIHNRIIASMAPSIYGHRSIKTAIAAALFGGVPKNINGKHKIRGDINVLLLGDPGTAK
SQFLKYVEKTAHRAVFATGQGASAVGLTASVRKDPITNEWTLEGGALVLADKGVCLIDEF
DKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCTIIAAANPIGGRYNTTIPFNQNVEL
TEPILSRFDILQVVKDTVNPEIDEQLANFVVSSHIRSHPAFDPNMDVLKKVPTETGIDAK
PIPQDLLRKYIHFAREKVFPRLQQMDEEKISRLYSDMRRESLATGSYPITVRHLESAIRL
SEAFAKMQLSEFVRPSHIDKAIQVIIDSFVNAQKMSVKRSLSRTFAKYLI
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggattcttttcggaaaaggggtcgccgcgattctgaaagtttaccttttgaatcagaa
aattcttctctcggtgctacacctctttctttacctccttcttcacctcctccagaattc
tctgatgaagctgcagaagctctcgtggaggaggatattgaggatctggacggagaagct
ttagatgtagaggatgaagaaggtgaagatttgttcggagaaggaatggaacgtgattat
caacaaaatttggagctagatcgttatgacattgaagaactagatgacgataacgatctt
gaagaattagatatcggggcccgaagagctgttgatgccaggttgagacgacgtgatatt
gagctcgatgctgctgcaggtagaacaaaacctgctgcatttttacaagatgaagatgat
gatttggactccaatcttggcacaggcttcactcgtcatcgacatcgaatttacgacgaa
tattcacctaatgttggcgcattggacgaatctggtgaacttcctcttgaatcaattgcc
gacgtaaaggccgatagtattgccgaatgggttactcttgatcctgttcggcgtacaatt
gctcgagaattcaaaaatttccttcttgaatatacagatgaaaatggcacctctgtatac
ggtaaccgtattcgcacattgggtgaggttaatgctgagtcgttgatggttaattatgcc
catcttggtgaatctaaacccattttggcttatttcttggccaatgcgcctgcacctatt
tttcgcatatttgatcgtgttgctttggaagccactcttttgcattatccagactatgaa
agaatacactctgatattcatgttcgtatcactaatcttcctacttgttttactttacgc
gatctacgacaatcccatcttaattgccttgtacgggtatctggtgtcgtaactaggcgc
actgggctttttccacaattaaaatacattcggtttacatgtaccaaatgtggtgctact
ttgggtccattttttcaagactctagcgttgaagtaaaaatttctttctgtcacaactgt
tccagccgtggtccgtttgtaatcaactctgaacggactgtatataataactatcaaagg
atcactttacaagaatcacctggcaccgtcccctcaggtagactgcctcgacaccgtgaa
gttattcttttagcggacttggttgatgttgccaaaccaggcgaagagattgatgttact
ggcatataccgcaataacttcgatgctagtctgaataccaaaaacgggtttcctgtcttc
gctacaattatagaagcaaatcacatatcgcaacttgacggcagtggtaatactgatgat
gatttctctttaagtcggcttactgatgatgaggaaagggaaattcgggcattagcaaag
tcgcctgatattcacaacagaattattgcatcgatggcgccttctatttatggacatcgc
tctatcaaaactgctattgctgctgctttattcggtggtgtccccaaaaatattaacggt
aagcataaaattagaggtgatatcaatgttttattgttgggagatccaggaaccgccaaa
tctcaatttcttaagtatgttgaaaaaacggcacatagggctgtcttcgccacaggtcag
ggtgccagtgctgttggtctaactgcatccgtccgtaaagaccccattacgaatgaatgg
actttggaagggggtgctttggttttagcagataaaggtgtttgtttgattgacgagttc
gataaaatgaatgatcaggatcgtacttctattcacgaagccatggaacaacaaagtatt
tctatttctaaggcgggtattgtgactaccttgcaggcgaggtgcactattattgctgcc
gctaatcccatcggtggacgttataacactacaattccttttaatcaaaatgttgagctg
accgaacctattttatctcgttttgacatccttcaggtcgtcaaagacacggttaatcct
gaaattgatgaacagctagctaattttgttgtatcaagtcatattcgatctcatcctgca
tttgatccgaatatggatgtcttgaagaaagtccctactgagactggtattgatgccaaa
cccattccccaagatcttcttcgtaaatatatccatttcgctcgtgaaaaagtttttcct
cgattacagcaaatggatgaagaaaagatttcgagactttatagcgatatgagacgcgag
tcactggctactggaagttatcctattactgtgcgtcatctggagtctgctatccgttta
agtgaagcatttgcaaaaatgcagctcagtgagtttgtgcgcccttcacatatagacaaa
gccattcaagtgattattgattcctttgtgaatgcccaaaaaatgagtgttaaacgaagt
ttgtcaagaacatttgctaaatatcttatttaa

DBGET integrated database retrieval system