KEGG   Schizosaccharomyces pombe (fission yeast): SPBC405.04c
Entry
SPBC405.04c       CDS       T00076                                 

Symbol
ypt7
Name
(RefSeq) GTPase Ypt7
  KO
K07897  Ras-related protein Rab-7A
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04138  Autophagy - yeast
spo04144  Endocytosis
spo04145  Phagosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPBC405.04c (ypt7)
   04145 Phagosome
    SPBC405.04c (ypt7)
   04138 Autophagy - yeast
    SPBC405.04c (ypt7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC405.04c (ypt7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC405.04c (ypt7)
   04031 GTP-binding proteins [BR:spo04031]
    SPBC405.04c (ypt7)
Membrane trafficking [BR:spo04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    SPBC405.04c (ypt7)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPBC405.04c (ypt7)
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC405.04c (ypt7)
  Exosomal proteins of colorectal cancer cells
   SPBC405.04c (ypt7)
  Exosomal proteins of bladder cancer cells
   SPBC405.04c (ypt7)
GTP-binding proteins [BR:spo04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    SPBC405.04c (ypt7)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 AAA_7 AAA_22 AAA_16 AAA_24 SRPRB Septin AAA_5 PduV-EutP cobW DAP3 TniB G-alpha NTPase_1 RNA_helicase ATPase_2 Sigma54_activat
Other DBs
NCBI-GeneID: 2540763
NCBI-ProteinID: NP_596307
PomBase: SPBC405.04c
UniProt: O94655
Position
II:complement(join(3147478..3147690,3147753..3148076,3148150..3148230))
AA seq 205 aa
MAGKKKHLLKVIILGESGVGKTSIMNQYVNRKFSKDYKATIGADFLTKEVLVDDKVVTLQ
LWDTAGQERFQSLGVAFYRGADCCVLVYDVNNSKSFETLDSWRDEFLIQASPSNPETFPF
ILLGNKVDVEEQKRMVSKSKALAFCQARGEIPYFETSAKEAINVQEAFETVAKLALENMD
SDDIAADFTDPIHLDMESQKTSCYC
NT seq 618 nt   +upstreamnt  +downstreamnt
atggccggcaaaaagaagcatttgctgaaagttattattttaggagaaagcggtgttgga
aagacttctatcatgaatcagtatgtgaatcgaaagtttagcaaagattataaagcaacc
ataggagcggattttcttaccaaagaagttctggtcgatgacaaagtcgttacattacag
ctctgggataccgctggtcaagagcggttccagagtttgggggttgcgttttatcgaggc
gcagattgctgtgtcctcgtttatgatgttaataacagcaagtcctttgaaactttagat
agctggcgcgacgaatttttgattcaagcatcaccgagcaatccagagacatttcccttt
atcttgcttggaaacaaggtcgacgtggaagaacaaaagaggatggtttcaaaatcaaaa
gcattggccttttgccaagctagaggagaaattccctatttcgagacaagtgctaaagaa
gctatcaatgttcaagaagcattcgaaacagtggctaagttagctctggagaacatggat
tctgacgatattgcggcagactttacagatcctattcatttagatatggagagtcaaaaa
acttcatgttactgttaa

DBGET integrated database retrieval system