KEGG   Schizosaccharomyces pombe (fission yeast): SPBC418.01c
Entry
SPBC418.01c       CDS       T00076                                 

Gene name
his4
Definition
(RefSeq) putative imidazoleglycerol-phosphate synthase
  KO
K01663  imidazole glycerol-phosphate synthase [EC:4.3.2.10]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00340  Histidine metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SPBC418.01c (his4)
Enzymes [BR:spo01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     SPBC418.01c (his4)
SSDB
Motif
Pfam: His_biosynth GATase SNO GATase_3
Other DBs
NCBI-GeneID: 2541224
NCBI-ProteinID: NP_596494
PomBase: SPBC418.01c
UniProt: O94303
Position
II:complement(join(3582095..3583600,3583707..3583826))
AA seq 541 aa
MIVSIVDYGSGNVRSLINAVRYLGFETQWIRNPHDIEKAECLIFPGVGNFGFVCDSLAKQ
GFLEPLRRYALSGKPFMAVCVGIQALFEGSVEAPHSKGLGVFPGLVQRFDNDDKTVPHIG
WNSCAVRSDTSKEFFGMRPHDKFYFVHSYMIPEKGLILPPEFKIATTKYGNETFVGAIVK
NNFLATQFHPEKSGSAGLRCLKAFLTGNYEQPISGEASKLIENSFGGLTKRIIACLDVRS
NDAGDLVVTKGDQYDVREKSSGSEVRNLGKPVELCQRYFQEGADEVVFLNITSFRNCPMA
DAPMLQVLEKAAQTVFVPLTVGGGIRDVSDPDGTFHPAVEVAGIYFRSGADKVSIGSDAV
YAAEKYYENGKKLSGKTAIETISKAYGNQAVVISVDPKRQYVKVPEDTKHHVVKTSRLGP
NGEAYCWYQCTVKGGREYRDIDVVELTRACEAMGAGEVLLNCMDQDGSNAGYDIELVRLV
KNSVNIPVIASSGAGIPQHFEEVFKETDCDAALAAGIFHRQTCRIEDVKEYLAIHDVLVR
T
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgattgtttcaatagttgattatggtagtggaaacgttcgatccttaatcaatgccgtt
aggtatttagggtttgaaacacaatggatcaggaatccccatgatattgaaaaagctgaa
tgcttgatttttcctggtgttggaaactttggtttcgtatgcgattccttagcaaagcaa
ggatttttagaacccttgcgtcgctatgctttgtctggcaaaccttttatggctgtatgc
gttggaatccaagcattattcgaggggtctgttgaagcaccacattctaaagggttgggc
gtatttccggggttagtccaaaggtttgacaacgatgacaagaccgtccctcatattggt
tggaattcttgtgctgtacgatctgacacttcaaaagagttttttggtatgcgcccacat
gacaaattttattttgtgcactcttatatgattccagaaaagggacttatccttcctcca
gagttcaaaattgctaccacgaaatatggaaatgaaacctttgtaggtgctattgtaaag
aataattttttagctacccaatttcatccggaaaaaagtggatctgcaggtttgcgttgt
ttaaaggcatttttaaccggtaattatgagcaacctataagtggtgaagcatctaaactt
atagagaactcctttggcggattaacaaagcgtattattgcttgcttagatgtccgttcc
aacgacgctggtgaccttgtagttacaaaaggtgatcaatatgatgtccgtgaaaaatct
tctggaagcgaggttagaaatcttggaaaacctgtggagttatgtcaaagatattttcaa
gaaggcgctgacgaagtcgtttttttgaacatcacttcatttagaaattgtccaatggcc
gatgcacctatgttacaggttttagaaaaggcagctcaaacagtatttgtacctttaaca
gtaggtggtggaatcagagatgtatcagatcctgatgggacttttcatcctgctgtcgaa
gttgctggtatttactttagatcaggtgccgacaaagtatctattggaagtgacgccgtt
tatgccgcagaaaagtattacgaaaatgggaagaaattgagtggaaaaactgctatagaa
acaatttctaaggcctatggtaatcaggcagttgttatttcggttgatcctaaacgtcag
tatgtaaaagttcctgaagatactaaacaccatgttgtgaaaacatctcggcttggacct
aatggagaagcatattgttggtatcagtgcaccgttaaaggaggtcgtgaatatcgtgat
attgatgttgttgaacttactcgtgcttgtgaagcaatgggtgctggtgaagtactatta
aattgtatggatcaagacggttcaaatgctgggtatgacatagaacttgttcgtcttgtt
aaaaactctgtgaatattccagtaatagcttcaagtggtgctggtattccccaacatttt
gaagaagtatttaaagaaacggattgtgatgcagctcttgccgccggaatttttcatcga
caaacttgtcgcatagaagacgtcaaagaatatctggcaatacacgacgttctggttcgc
acttag

DBGET integrated database retrieval system