KEGG   Schizosaccharomyces pombe (fission yeast): SPBC428.02c
Entry
SPBC428.02c       CDS       T00076                                 

Gene name
eca39
Definition
(RefSeq) branched chain amino acid aminotransferase Eca39
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00270  Cysteine and methionine metabolism
spo00280  Valine, leucine and isoleucine degradation
spo00290  Valine, leucine and isoleucine biosynthesis
spo00770  Pantothenate and CoA biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01210  2-Oxocarboxylic acid metabolism
spo01230  Biosynthesis of amino acids
spo01240  Biosynthesis of cofactors
Module
spo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
spo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPBC428.02c (eca39)
   00280 Valine, leucine and isoleucine degradation
    SPBC428.02c (eca39)
   00290 Valine, leucine and isoleucine biosynthesis
    SPBC428.02c (eca39)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SPBC428.02c (eca39)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPBC428.02c (eca39)
Enzymes [BR:spo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SPBC428.02c (eca39)
Amino acid related enzymes [BR:spo01007]
 Aminotransferase (transaminase)
  Class IV
   SPBC428.02c (eca39)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 2540831
NCBI-ProteinID: NP_595180
PomBase: SPBC428.02c
UniProt: O14370
Position
II:complement(442631..443914)
AA seq 427 aa
MSLMFLRRAGNIKGRNIRFALQRGSVGYSQQSSEACKNFLNTTQLRTMVQTAALHGPKPM
DSSHIKVTNVKELKPLPEWKSLKFGENFTDHMLIMKWNREKGWSTPEIVPFGKLCFHPAS
SVFHYGFECFEGMKAFRDEKGVPRLFRPIKNAERMLSTGTRISLPSFDPAELAEIIRKFV
AHENRWVPDQRGYSLYIRPTFIGTDEALGVHHCDNAMLYVIASPVGPYYSSGFKAVKLCC
SEESVRAWPGGTGHYKLGGNYAPSVLPQKEAAKKGYAQILWLYGDEDYITEVGTMNCFTV
WINKNGEKEIITAPLDGMILPGVTRDSILEICRERLAPKGWKITEGKYSMKEVAQASKEG
RLLEVFGAGTAALVSPVKAINYKGTEYEIPMPEGQEAGPITSEISKWILDIQYGKEPNNP
WSVPALP
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagtttaatgtttttgaggagagcgggcaatataaaaggcagaaatattcgctttgcc
cttcaacgtggctctgtaggttattctcaacaaagctctgaggcttgtaaaaatttcctc
aacactacacaacttcgtaccatggttcaaactgctgctctccatggcccaaagcccatg
gatagctcccatataaaagttactaatgttaaggagcttaaacctttgcccgaatggaag
agtttgaagtttggtgagaattttactgatcatatgcttattatgaaatggaacagagaa
aagggttggagtactcctgagatcgttccatttggtaaactttgctttcaccctgcttcc
tccgttttccattatggttttgagtgctttgaaggcatgaaagctttccgtgacgaaaag
ggtgtcccacgtcttttccgtcccatcaagaatgctgagcgtatgctttcaactggtact
cgtatatctcttccttccttcgaccctgctgagcttgctgaaattatcagaaagttcgtc
gctcacgaaaaccgttgggtccctgatcagcgtggttactctttgtacattcgtcctact
ttcattggtactgatgaagccttaggtgtccaccattgtgacaacgctatgctttatgtt
attgcctctcccgttggcccctactacagctctggtttcaaggccgttaagctttgttgc
tccgaagaatccgttcgtgcttggcctggcggtactggtcactacaagcttggtggtaac
tatgctcctagtgttttgcctcaaaaagaggctgccaagaaggggtatgctcagattctc
tggctttatggagacgaggactacattactgaggttggtactatgaactgctttactgtt
tggattaacaagaatggcgaaaaagaaatcattactgcccctcttgacggtatgatctta
cctggtgtcactcgtgattctattttggaaatttgccgtgaacgtctcgcacctaaaggc
tggaagattactgagggcaagtattccatgaaagaggttgctcaagcttctaaggaaggt
cgccttttggaagtctttggagctggtactgctgcccttgtttcccccgtcaaggctatt
aactacaagggtactgagtatgaaattcccatgcctgagggtcaggaagctggtcccatc
acttctgaaatcagcaaatggattttggatatccaatacggcaaggaacctaacaaccct
tggagcgttcctgctttgccttaa

DBGET integrated database retrieval system