KEGG   Schizosaccharomyces pombe (fission yeast): SPBC428.05cHelp
Entry
SPBC428.05c       CDS       T00076                                 

Gene name
arg12
Definition
(RefSeq) putative argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00220  Arginine biosynthesis
spo00250  Alanine, aspartate and glutamate metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPBC428.05c (arg12)
   00220 Arginine biosynthesis
    SPBC428.05c (arg12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC428.05c (arg12)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     SPBC428.05c (arg12)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC428.05c (arg12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC
Motif
Other DBs
NCBI-GeneID: 2541050
NCBI-ProteinID: NP_595183
PomBase: SPBC428.05c
UniProt: O94354
Position
II:complement(449771..451003)
Genome map
AA seq 410 aa AA seqDB search
MPQEVKRCVLAYSGGLDTSCILAWLIEEGWEVICYMANVGQEEDWDAAREKALKVGAKKV
YVEDLREEFINDTVIPAAQANAIYENVYLLGTSLARPIIARRQIQIAEKENCIAVSHGCT
GKGNDQVRFELAYYALKPDVQVIAPWRLPVFFERFAGRKDLLEYAAAKGIPVTQTTKKPW
SMDENIVHCSYEAGILEDPSMTPPKDMWKLTVDPKDAPDEVEELSIHFEKGAPTKLECKD
GTFSGVVSIFYQLNAIARRNGVGRIDIVENRFSGLKSRGCYETPGLTILRTAHMDLEGLT
MEREVRALRDQFVTFNLAKILYNGQFFSPCTRMLLAANNVSQEVVNGVVKLSVYKGNVTV
LGRKSDTAHLYDEKLSSMDELGGFDPTWTSGFIQIESMRLRNSDEGKHWM
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagaagtaaaacgttgcgttctcgcctattcaggtggtcttgacacctcctgt
atcctcgcctggcttattgaagaaggttgggaggtcatctgctatatggctaatgttggt
caagaggaagattgggatgcagcccgtgaaaaggccttgaaggtgggtgctaagaaggtt
tacgttgaggacttgcgtgaagagttcatcaatgacaccgtcattcctgctgctcaagct
aacgccatttacgaaaatgtttatctcttgggcacttctcttgctcgtcctatcattgct
cgccgtcagatccaaatcgccgagaaggaaaactgtatcgctgtctctcacggttgcact
ggtaagggcaacgatcaagttcgtttcgaattggcatattacgctttgaagccagacgtt
caagtcattgctccttggcgtttgcctgtatttttcgagcgcttcgccggtcgtaaggat
ttgctcgaatatgctgctgctaagggcattcccgttactcaaaccaccaaaaagccttgg
tctatggatgaaaacattgtacattgctcgtatgaagctggaatcctcgaggatcccagt
atgactcctcccaaggacatgtggaagctcaccgttgatcccaaagacgctcctgatgag
gttgaagagctcagcattcactttgaaaagggtgctcccaccaaattagagtgcaaggat
ggtacctttagcggagtcgtttccatcttctaccaattgaacgctatcgctcgtcgtaac
ggtgttggtcgtatcgatattgttgaaaaccgtttctctggtttgaagagtcgtggttgt
tacgaaactcctggcttaaccattttgcgtactgctcatatggacttggaaggtttaaca
atggaacgtgaagttcgtgctctccgtgaccaattcgttactttcaatctcgctaaaatt
ttgtacaatggacaatttttctctccctgcactcgtatgcttttagcagctaacaacgtt
tctcaagaggtagtaaacggtgtagttaaactttctgtctacaagggcaatgtcactgtc
ctcggtcgtaaatctgatactgctcatctttatgacgagaaattgtcatctatggatgag
cttggtggatttgaccctacatggacctctggtttcatccaaatcgagtctatgcgtttg
cgtaactctgatgaaggaaaacattggatgtaa

DBGET integrated database retrieval system