KEGG   Schizosaccharomyces pombe (fission yeast): SPBC4B4.11
Entry
SPBC4B4.11        CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: IGR
Other DBs
NCBI-GeneID: 2540876
NCBI-ProteinID: NP_596428
PomBase: SPBC4B4.11
UniProt: O74972
Position
II:join(3433726..3433819,3433870..3434117)
AA seq 113 aa
MLILKRIFIIRNFIFPFSNCRYASTVPSPRSGISNTNDFFKRIGRDTAEKVNGKFESWDG
LFRKSTKTMKKEGIDVRTRKYIASQRNRFKEGFIVKPYPVMVKKNGGERRKRK
NT seq 342 nt   +upstreamnt  +downstreamnt
atgttgatcttgaagaggattttcattataagaaattttatatttcctttttctaactgc
cggtatgcctctactgttcctagtccaagatcagggatttctaatacaaatgatttcttt
aaaagaattggaagagatactgcagaaaaagtgaacggaaaattcgagtcttgggatggt
ctatttaggaaaagtacaaaaactatgaaaaaggaaggtattgatgtacgtacaaggaaa
tacattgcaagccaaagaaaccgatttaaagaagggtttatagttaagccatatccagtt
atggttaaaaagaatggaggtgagcgacgcaaacgtaaataa

DBGET integrated database retrieval system