KEGG   Schizosaccharomyces pombe (fission yeast): SPBC4C3.06
Entry
SPBC4C3.06        CDS       T00076                                 

Gene name
syp1
Definition
(RefSeq) putative cytoskeletal protein Syp1
  KO
K20042  F-BAR domain only protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC4C3.06 (syp1)
Membrane trafficking [BR:spo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    SPBC4C3.06 (syp1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    SPBC4C3.06 (syp1)
SSDB
Motif
Pfam: muHD FCH EXOSC1
Other DBs
NCBI-GeneID: 2540862
NCBI-ProteinID: NP_596299
PomBase: SPBC4C3.06
UniProt: O43059
Position
II:complement(join(3124204..3126618,3126660..3126701))
AA seq 818 aa
MESLTKTEYVDAFLSNYSPNDSMSIFRQRLEQVRLDNDMLSQWIRERMDIERQYSDQLHK
LAMNMQEKNNSSFAFNYAWKQLEGETLEISRYHSQIIGQIASQVYKPLIDYYTSSPQTAT
LRRLAERLSTVAEEMASSSVPGLKGLKKKGRDADTKSQNDLTASRATWDSDAPLAFEKLQ
IVDEERLLILKQVYLTIASLETDTALKQQEFFSKSMAVYSDLPIEGEIRQFMNSTSKVMS
SASANKPSKSSGFHINNGKSKEEKSHGENESGGKLKNKMSTLFRRKTIMPKKDKKPSHKS
NGRPNKLTAFFNKNSKASSISSAEEHPSNIDDSSIERRHYDSNHSSQIRDHPSTNNNASS
YQNFNETSDEGEDNDATIRANNVRSSFLEAPLPVQPNVQAETVTPKISSKASPFNKPNSV
HSEASRNTPSSIDRENASHSNPIMMHGNDFGGNFNNMQSRSTTTSPTSAVASPAPTENED
SNAAIERVANTLRKNPTISRRTRRAGTMDRYATASSDYMESNLGSLPNLSTLSLQSGPDS
TATWHPEFPNSSGLSASIVEKYSGELSEDGLLHPSCSGHIFMKYTSDFNTPPPEMGVRVA
SEFPMSFTHLNDHAVKYGPSENTLSLIPELLLSPIKVTDFNLHLDSINGASCIPLTVVQK
WKHDESSSSMIAFVKPNPVWRNLGSSLHIEKLVIIVYLGENVLVKSCQSSPAGEFSRKTS
KLKLHLSNINISSSGFKILAKFAISPSAAIRKPVIEFRIRMVDSSNNPGLTKLFLKPDMF
DTTSSSGGSQLESAYEETKVPTSYGIHVRECSVFADMS
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggaatcattgacgaaaacggagtatgtagatgcgtttttgtcaaactactctccaaac
gacagcatgtcgatctttcgacagcgcctagagcaagttcgcctagacaacgacatgctt
tcgcagtggattcgtgagcgaatggatattgaacggcaatactcagatcaattacataag
cttgcaatgaacatgcaagaaaaaaacaattcatcgtttgcttttaattatgcttggaaa
cagctcgagggagaaacccttgaaatttcaagatatcacagtcaaatcattggacaaata
gcttcgcaagtttataaacctttgatagattattatacttcttcaccacaaacggctacg
cttagacgtttagcagagcggttatcaacagttgcagaggagatggcatcgtcttctgta
cctggtctgaagggattaaaaaaaaaaggccgtgatgcggatactaagagtcagaatgat
ctcactgcttctcgtgcaacctgggattccgatgctcctttagcgtttgaaaaattgcaa
attgttgacgaggaacgcctccttatattgaaacaagtttacctgacaattgcaagtttg
gaaactgatacggctcttaaacagcaagaatttttttctaaatctatggcagtttattct
gatctacctattgaaggtgaaatccgtcaattcatgaactccacatcgaaagttatgtct
tccgcatctgctaataaaccatctaagtcatcgggctttcacataaacaatggaaaatct
aaagaggaaaagagtcatggagaaaatgaatctggtggtaaattgaagaacaaaatgtcc
acgttgtttcgtcggaaaaccataatgcctaaaaaggataagaagccttcgcataaatct
aatggtcgccctaataaattaactgctttttttaataagaactccaaagcttcgagtatt
tcgtctgctgaagaacacccatcgaatatagatgatagttcaatcgaacgaagacattat
gattccaatcattcttcacaaattcgggatcatccctctactaataataacgcttcgtct
tatcaaaactttaatgaaacttccgacgagggcgaggacaacgatgccactattcgtgca
aacaatgttcgctcatcctttttggaggctccgctacctgtgcagcctaatgttcaagca
gaaacggttacgcctaagatttcctccaaggcttccccctttaataaacccaattctgtg
cactctgaagcctcaagaaataccccttcatcgatcgatagagagaatgcatcacattcg
aatcctatcatgatgcatggcaatgattttggtgggaactttaacaacatgcaatcacga
tcaacaacaacgtctcccacatcagcggtggcttcccctgcgcctactgaaaacgaggat
agcaatgctgcaattgaaagggtagcaaatactttacgaaagaatcccactatatcaaga
aggacccgtcgtgctgggacaatggatcgttatgctacagcatcgtctgactatatggaa
tcaaacctcggtagcttgcccaatttgtctactttatcattacaatcgggaccagactcg
actgcaacatggcaccctgagttcccaaattcttccgggctttctgcttcaatcgtcgaa
aagtattctggtgaattatctgaagatggccttcttcatccttcctgttccggtcatata
ttcatgaaatatacctcggattttaatacccctcctcctgaaatgggtgttcgcgttgcg
tctgaatttcctatgtcttttactcatttaaatgaccatgcagtaaaatatggaccctca
gaaaacacactttctttaataccagagctacttctctcaccaatcaaagtcactgatttt
aatctacatcttgatagtattaacggtgctagttgcattccattgacagttgttcagaaa
tggaagcatgatgaaagcagtagtagtatgattgcatttgtgaagcctaatcctgtgtgg
aggaacttaggctcatctcttcatattgaaaaacttgttatcatcgtttacttgggggaa
aatgtccttgtaaaaagctgtcaaagttctccggccggagaatttagcaggaaaactagt
aaacttaagctacatctttcgaacattaatatatcttcgtctggatttaaaattttagcc
aagtttgcgattagtcctagtgctgctattagaaagccagttatcgagttccgtattcgc
atggttgattcctctaataaccctggtctcaccaaattgtttttgaaaccagatatgttt
gatactacttcttctagtggaggttctcagctagaaagtgcttatgaagaaacgaaggtt
cctacttcctatggtattcatgttcgtgagtgctctgtttttgctgatatgagttaa

DBGET integrated database retrieval system