KEGG   Schizosaccharomyces pombe (fission yeast): SPBC4C3.09
Entry
SPBC4C3.09        CDS       T00076                                 

Definition
(RefSeq) putative acetylglucosaminyltransferase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Glyco_transf_8 Mannosyl_trans3
Other DBs
NCBI-GeneID: 2540859
NCBI-ProteinID: NP_596296
PomBase: SPBC4C3.09
UniProt: O43062
Position
II:complement(3119227..3120357)
AA seq 376 aa
MNFFKRLRLHTRLLLRSKFVLISLILLLNLGLLLGIQIYRDPAFPGSLISSAAYEFGLHK
HGPYYNDNVDDLKRYTFMGLLTLPTSEHDVYFNATRVLVYKLKHHPETKSKYPVHVLVMK
GVDEWKIERLRLDGAEIIMVDQIKTEDLIESGLSIGMGSYRYQYMFTKLSVFEQTQFDKV
CILDSDLLVLKNMDDIFDTPYVYESPAEPDMFSFPIFKKPDDEEDYQFSDNFDAYGAPRS
EFYPYLLGACDDRNPGHATPPEESETFNAGLMLVHPSSLHMHRIKKIARYPYMYDDARMM
EQSLLNLAYNKYGWFPWTRLDFSYNGVWVTEEDLPYLRAAHGKFWEYDNTEFPQILTAEW
HKAFGELLAFHDYVVE
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaatttctttaagcggttacgcttacataccaggcttctacttcgctcaaaatttgtc
ttgatttcactaattcttttgctgaatttgggtttacttttagggatccaaatatatcgg
gatcccgcatttcctggatcgctaatttcatcggcagcctatgaatttgggcttcataag
catggcccatattataacgataatgtagatgatttaaaaaggtatacatttatgggctta
cttacccttcctacttcagaacatgatgtatacttcaatgctactcgagtactagtatac
aagctgaaacatcatcctgaaacgaaaagtaaatatcccgttcatgtccttgttatgaaa
ggggttgatgaatggaaaattgaacgattgcgacttgatggggccgaaataattatggtc
gatcaaattaaaactgaagacttaattgaaagtggtttgtctattggcatgggcagttat
cgttatcaatacatgttcacaaaactcagtgtatttgagcaaacacagtttgataaggtc
tgcattctggatagcgatctcctagtattgaaaaacatggatgacatttttgatactccc
tatgtttatgaatctcctgcagaacccgatatgtttagctttcctatctttaagaagcca
gatgatgaagaggattatcagtttagcgacaatttcgatgcctatggtgctcctcgctca
gaattctatccatatcttcttggcgcatgtgacgatcgtaaccctggacatgcgacgccc
ccagaagaatctgaaacttttaatgccgggctgatgcttgttcatcccagtagtcttcat
atgcataggattaagaagatagcacgttatccttatatgtatgacgatgctagaatgatg
gaacaaagtttattaaatcttgcttataataaatatggttggtttccctggacgaggctc
gatttttcatataatggagtttgggtcaccgaagaggacttaccctatcttcgtgctgct
catggtaaattttgggaatatgacaacacggagtttccccaaattttgactgccgagtgg
cataaagcgttcggagagttgctggcttttcatgactatgttgtagaataa

DBGET integrated database retrieval system