KEGG   Schizosaccharomyces pombe (fission yeast): SPBC4F6.09
Entry
SPBC4F6.09        CDS       T00076                                 
Symbol
str1
Name
(RefSeq) siderophore-Fe(3+) transporter Str1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: TRI12 MFS_1 DUF4193
Other DBs
NCBI-GeneID: 2540217
NCBI-ProteinID: NP_596109
PomBase: SPBC4F6.09
UniProt: O74395
Position
II:2705523..2707361
AA seq 612 aa
MRLKSFSTTLDTLRRRFNDSSSEEDKLEKNIQDETSIKEVSLQDAKQSDEKGVEEKVFND
ESFSIDVAPKPEDELSGIVKARYLTEHSSRISFYICYFSIFLLFFAISFQAECYYSLTAY
ATSAFAGHSLLSTIAVANNIISAAIKPPLARLSDVFGRLEAFLFSLLLYLVGLILMAAST
NVQTYAGGSVLYNAGYTGVELIMTIFMADTSSMANRSLVLGISYLPFVVTIWIGPRVAQE
FYMHSTWRWGIAVWTILIPACSIPFLAVYSYYQFRAWREGALKGTLTINPVELFKKLDII
GLILMTAGLALVLLSISLASYDTGKWSDAKFIVMIIIGGLCLIAFVLYEIFVASFPALPF
RLMREPTIGACCAMSFLFYITFYCWDNYYYSFLQVVHYTSITAAGYISYTYSFTSCATGF
FLGILIRLTKRYKWYFVASIPVYILGQGLMIRYRGEQYNWGYQIMPQIIVGIGGGVIANL
LTVAVQTVVSTENFAIVTALVSTVTPIGGAVGSAISGAIWNSVMPKRLEKNLPSDLKDQA
YTIFESLTVQLSYTRGTDARNAIILSYSEVQKILTSVATGFAGAMIFPVWFVANPRLSTV
KTHIFDSKESKV
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgcgtctgaaatcattctccacaactctcgatacattgcgaagaagatttaacgattct
agtagcgaagaggataaattggaaaaaaacattcaggatgaaacttccataaaggaagtt
tcattgcaagatgcaaagcaatccgatgaaaagggtgttgaggaaaaggtttttaatgac
gagagcttttctatcgatgtcgcccctaaacccgaagatgaactttctggcattgtcaaa
gctagataccttaccgaacattcctctaggatctctttttacatatgctatttttcaatt
tttttgcttttcttcgccattagtttccaagcagaatgttattattcattaactgcttat
gctacttctgcttttgcaggtcattcattgctttccaccattgcagttgcaaacaatatt
atttctgctgccattaaaccccctcttgctcgtctctcagatgtctttggacgtctggaa
gcttttctcttctctcttttactttacctagtcggtctcattttaatggccgcttccacg
aatgttcaaacatatgctggtggtagtgttttgtataatgctggatacactggcgttgag
ttgattatgacaatctttatggcggatacctcttctatggctaaccgctctcttgtttta
ggcatttcttacctgccattcgtcgtaacaatttggatcggccccagagttgcgcaggaa
ttttatatgcattctacatggcgctggggtattgctgtatggaccattcttattcctgct
tgctctattcctttccttgccgtttattcatattatcaattccgagcttggcgggagggt
gctttgaagggaacgcttacaattaaccctgttgaattgttcaaaaaactcgacattatt
ggtttaattttgatgactgcgggccttgcccttgtcctgctttccatcagtttggctagt
tatgatactggaaaatggagtgatgctaaattcatcgttatgattattattggtggttta
tgtcttattgcttttgttttatatgaaatatttgttgccagtttccctgcattgccattc
cgtcttatgcgtgagcctactattggagcttgctgtgctatgtcttttctgttctacatc
accttttactgttgggataactactattatagtttcttgcaagtcgttcattacacatct
attactgctgctggatacatatcatacacctactcattcacttcttgtgcaaccggattc
tttttgggaattctcattcgtcttactaagagatacaaatggtactttgttgcttcaatt
cctgtttacattcttggccaaggtttaatgattcgatacagaggcgagcaatataattgg
ggttatcaaattatgcctcaaattatcgttggtattggtggtggtgttattgcaaatcta
cttactgtcgctgttcaaactgttgtcagcactgagaattttgctattgtcacagccctt
gttagtaccgttacacccatcggtggtgctgttggaagtgctatatcgggtgcaatctgg
aacagcgtgatgcccaagcgtttagaaaagaatctaccaagcgacttgaaagaccaagca
tataccatttttgagagtttaaccgtccaattaagttatactagaggcactgacgctaga
aatgccatcattctttcttatagtgaagtccaaaagattttgacgagtgtcgcaactggt
tttgctggtgccatgatatttccggtttggttcgtcgctaatcccagactttcaacagtc
aaaacccacatttttgattcgaaggaaagcaaagtttaa

DBGET integrated database retrieval system