KEGG   Schizosaccharomyces pombe (fission yeast): SPBC4F6.15c
Entry
SPBC4F6.15c       CDS       T00076                                 
Symbol
swi10
Name
(RefSeq) DNA repair endonuclease Swi10
  KO
K10849  DNA excision repair protein ERCC-1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC4F6.15c (swi10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC4F6.15c (swi10)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     SPBC4F6.15c (swi10)
SSDB
Motif
Pfam: Rad10 HHH HHH_5 FANCI_HD1 HHH_2
Other DBs
NCBI-GeneID: 2540887
NCBI-ProteinID: NP_596115
PomBase: SPBC4F6.15c
UniProt: Q06182
Position
II:complement(2718967..2720391)
AA seq 252 aa
MSDIDDEEFEQLAVSALEEVEKKAGFAQQPTPQKVSRVTAHSILVNPRQKGNPLLPHVRN
VPWEYTDIVPDFVMGTGICSLFLSLKYHHLHPEYIYSRISKLGKSYNLRILLILVDVENH
QASIQELVKTSIVNQYTLILAWSSEEAARYLETYKAYENMSPALIMEKPSTDYLSQVQSF
LTSIRGINKSDSLSLLSKFGSLERALVASRDELEQLEGWGPTKVNRFLEAVQQPFMSHST
IKRPEAINLKQT
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctgatatcgatgatgaggaatttgagcagcttgcagttagcgccttagaagaagta
gagaaaaaagctggttttgctcaacagccaactcctcaaaaagtgtctagggttacagct
cactctattttggtaaaccctcgacagaaaggaaatcctttattgcctcacgttcgaaat
gtaccatgggaatacaccgacatagttcccgattttgttatgggaacaggtatttgctct
ttgttcttaagcttgaaataccatcacttgcatcctgaatacatttattcacggatatct
aaactcgggaaatcatacaatttaagaatcttactgattttagttgatgttgagaatcac
caggcttcaattcaagaattagtcaaaactagtatcgtgaatcagtatacacttattttg
gcctggtcttctgaagaggctgctcgatatctagaaacgtataaggcttatgaaaacatg
tcacctgcacttataatggagaagccatcaactgattatctttctcaggtgcaatctttt
ttgactagtattcgcggtatcaacaagagcgatagcctgtcccttttatcaaagtttggt
tctttagagagagctttagtggcttccagagatgaactagaacagttagaaggatggggt
cctaccaaggtcaatcgttttctagaagcagtgcagcagccttttatgtcccattctacc
attaaaagacctgaagcaataaatttaaaacaaacttga

DBGET integrated database retrieval system