KEGG   Schizosaccharomyces pombe (fission yeast): SPBC4F6.17c
Entry
SPBC4F6.17c       CDS       T00076                                 
Name
(RefSeq) putative protein Hsp78
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPBC4F6.17c
Chaperones and folding catalysts [BR:spo03110]
 Heat shock proteins
  HSP100
   SPBC4F6.17c
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 ClpB_D2-small AAA AAA_5 AAA_16 AAA_22 Sigma54_activat NACHT ATPase_2 AAA_7 IstB_IS21 AAA_14 Mg_chelatase TsaE ABC_tran AAA_30 AAA_24 DNA_pol3_delta2 T2SSE RuvB_N HAUS2 Orbi_NS1 AAA_13 AAA_23
Other DBs
NCBI-GeneID: 2540898
NCBI-ProteinID: NP_596117
PomBase: SPBC4F6.17c
Ensembl: SPBC4F6.17c
UniProt: O74402
Position
II:complement(2723119..2725730)
AA seq 803 aa
MNILPKSIPIRIQSLRRYQGSLKTSLRALSTRPIFEKRLLAETPFSIRPSNASVLIAKRS
PKFGWKQVRFYAANPNGGNFRMDLGGGRKQGAALEEYGTDLTALAKQGKLDPVIGREEEI
QRTIQILSRRTKNNPALVGPAGVGKTAIMEGLASRIIRGEVPESMKDKRVIVLDLGALIS
GAKFRGDFEERLKSVLSDLEGAEGKVILFVDEMHLLLGFGKAEGSIDASNLLKPALARGK
LHCCGATTLEEYRKYIEKDAALARRFQAVMVNEPSVADTISILRGLKERYEVHHGVRITD
DALVTAATYSARYITDRFLPDKAIDLVDEACSSLRLQQESKPDELRRLDRQIMTIQIELE
SLRKETDTTSVERREKLESKLTDLKEEQDKLSAAWEEERKLLDSIKKAKTELEQARIELE
RTQREGNYARASELQYAIIPELERSVPKEEKTLEEKKPSMVHDSVTSDDIAVVVSRATGI
PTTNLMRGERDKLLNMEQTIGKKIIGQDEALKAIADAVRLSRAGLQNTNRPLASFLFLGP
TGVGKTALTKALAEFLFDTDKAMIRFDMSEFQEKHTIARLIGSPPGYIGYEESGELTEAV
RRKPYAVLLFDELEKAHHDITNLLLQVLDEGFLTDSQGRKVDFRSTLIVMTSNLGSDILV
ADPSTTVTPKSRDAVMDVVQKYYPPEFLNRIDDQIVFNKLSEKNLEDIVNVRLDEVQQRL
NDRRIILTVTEAARKWLAEKGYSPAYGARPLNRLIQKRILNTMAMKIIQGEIKSDENVVI
DVLDGELEFKANKLEPQSTSHED
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgaatattttacctaagagtattccgatacgaatacaatcgctccgtaggtaccaagga
agtttaaaaacttctcttcgggcattgagtactcgacccatttttgaaaaacggctgtta
gctgaaacaccattttctataagaccaagtaatgcttctgtactcatagctaagagatct
ccaaagtttggatggaagcaagtacgcttttatgcagcaaatccaaatggaggaaatttt
cgaatggatttaggcggcggacgcaaacaaggagccgctttggaagaatatggcacagac
ttaacagccttggctaaacaaggaaaattggatcctgtaattgggcgtgaagaagagatt
caaagaaccatccaaattctctctcgacgcacaaagaataatcctgcgttagttggtccg
gctggtgtaggtaaaacagcaattatggagggattagcctcgcgaatcattcgtggagag
gtccctgagtccatgaaggataaacgtgttattgtcctagatttaggcgctctcatttca
ggagccaaatttcggggagattttgaggaacgtttaaaatctgtactgagtgacctggaa
ggagctgaaggaaaggtcattttgtttgttgatgaaatgcaccttttacttggctttggt
aaagctgaaggctcaattgatgccagcaatctattaaaacctgctttagcccgtggtaaa
ttgcactgttgtggtgcgacaaccttggaggaatacagaaaatacatcgagaaagacgct
gctttggcaagaagatttcaagcagttatggtaaatgaaccttctgtagctgacaccatc
tcaattcttcgtggtctgaaagaacgatacgaagttcatcatggtgtacgtatcactgac
gatgctttggtaacagcagctacgtacagcgctagatacatcaccgatcgatttcttccc
gataaagccattgatttagtcgatgaagcctgctcctctcttcgcttacaacaagagtct
aaacctgatgaattgcggcgtttagaccgtcaaatcatgactatacaaattgaattggaa
tcccttaggaaggaaactgacacgacatcggttgagcgacgtgagaaattggagtccaag
ctcactgatttgaaggaggaacaagataaactatctgcggcatgggaagaagagagaaag
cttttggactccatcaagaaggctaaaactgaacttgaacaggctcgaatagagcttgag
agaacacaacgtgaaggtaattatgcccgtgcttctgagctccaatatgcgattattcct
gaattggagcgtagtgttccaaaggaagagaaaacgcttgaagaaaagaagccatccatg
gtacatgattcggttactagcgatgatattgcggttgttgtatcaagggcgacaggaatt
cctaccactaatttaatgcgtggtgaaagagacaagctccttaatatggaacaaactatt
ggcaagaagattattggtcaggacgaagctttgaaagcgatagccgatgcagttcgttta
tcacgcgcaggtctccaaaacaccaacagacctttggcatcattccttttccttggacct
accggtgtaggtaagactgcacttaccaaagctttagcagagtttctatttgacactgac
aaggctatgattcgttttgatatgtccgagtttcaggagaaacatacaattgcgcgtctg
attggtagtcctcctggatatattggttatgaagaatctggagagttgactgaagctgtg
cgtcgcaaaccatacgccgtacttttgtttgacgaattagaaaaagcgcatcatgatatt
accaaccttcttctacaagtactagacgaaggatttttgaccgattcacaaggacgtaaa
gtggatttccgatctaccttgattgttatgacctcgaatttgggaagcgatatcttggtt
gctgatcctagtactactgtcacccccaaatccagggatgccgttatggatgttgtacag
aaatattatcctcctgaatttttgaacagaattgacgaccaaattgttttcaacaaatta
tcggaaaagaaccttgaagacatagtaaacgttcgtttggacgaagttcaacaacgtctt
aatgaccgtcgtataatccttacagttacagaagcagctcgcaaatggcttgctgaaaaa
ggttattctccagcgtatggcgctagacctttgaatcgcttaatacagaagcgtattttg
aacacaatggcgatgaaaattattcagggagaaattaagtcggacgaaaatgttgtgatc
gacgttttggatggtgaacttgagtttaaagcaaataagcttgagccacaatctacaagt
catgaggattaa

DBGET integrated database retrieval system