KEGG   Schizosaccharomyces pombe (fission yeast): SPBC530.03c
Entry
SPBC530.03c       CDS       T00076                                 

Gene name
bag102
Definition
(RefSeq) putative BAG family molecular chaperone regulator Bag102
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: BAG DUF1319
Other DBs
NCBI-GeneID: 2540564
NCBI-ProteinID: NP_595316
PomBase: SPBC530.03c
UniProt: O59739
Position
II:complement(791259..791879)
AA seq 206 aa
MSFFTQLCSMDKKYWISLAVLSVTVLISALLKKRATETEDIVVVHYDGEKLNFVLRQPRL
NMVSYTSFLRRVCNAFSVMPDKASLKLNGVTLKDGSLSDQNVQNGSELELELPKLSPAMQ
QIEAYIDELQQDLVPKIEAFCQSSPASAQDVQDLHTRLSETLLARMIKLDAVNVEDDPEA
RLKRKEAIRLSQQYLSKLDSTKNQNK
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtctttttttacccagttgtgttctatggataaaaaatattggatctctctagctgta
ttgtcagttactgttttgattagcgcattattgaaaaagagagctactgaaaccgaagat
attgtcgttgttcattacgatggcgaaaagttgaattttgtgttgcgacaaccaaggctg
aatatggtttcttacactagttttcttcgtcgcgtgtgcaacgcattttcagtaatgccc
gacaaagcgtctctcaagttaaacggggtgaccctcaaggatggttcactttccgaccaa
aatgtgcaaaatggaagtgaattagagctcgaattacccaaactgagcccggcaatgcaa
caaattgaagcatatatagatgagcttcaacaggatctcgtccctaaaattgaagccttc
tgccaatcgtctcccgcttcggcacaagatgttcaagatttgcatacacgccttagtgaa
acattgttggctaggatgataaaattagatgctgttaatgttgaagacgacccagaagct
cgtcttaaaagaaaagaagctattcgtttatctcaacaatatttgagtaaactagattcc
accaagaatcaaaacaaatga

DBGET integrated database retrieval system