KEGG   Schizosaccharomyces pombe (fission yeast): SPBC530.10c
Entry
SPBC530.10c       CDS       T00076                                 
Symbol
anc1
Name
(RefSeq) adenine nucleotide carrier Anc1
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPBC530.10c (anc1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC530.10c (anc1)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPBC530.10c (anc1)
Transporters [BR:spo02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   SPBC530.10c (anc1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 2540900
NCBI-ProteinID: NP_595323
PomBase: SPBC530.10c
Ensembl: SPBC530.10c
UniProt: Q09188
Position
II:complement(811060..812897)
AA seq 322 aa
MATSSAAAAASTPVNANTITETKNSTFFFDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE
MIRAGRLSHRYKGIGECFKRTAAEEGVISLWRGNTANVLRYFPTQALNFAFKDKFKKMFG
YKKERDGYAKWFAGNLASGGAAGAASLLFVYSLDYARTRLANDAKSAKKGGERQFNGLVD
VYRKTYRSDGLRGLYRGFGPSVVGIVVYRGLYFGMYDTLKPVVLVGPLEGNFLASFLLGW
AVTTGSGVASYPLDTIRRRMMMTSGEAVKYSSSFECGRQILAKEGARSFFKGAGANILRG
VAGAGVLSIYDQVQLLMFGKKF
NT seq 969 nt   +upstreamnt  +downstreamnt
atggctacttcatctgctgccgctgctgctagcacccccgtgaatgcaaacaccatcact
gaaacaaagaactctactttcttctttgatttcatgatgggtggtgtttctgctgctgta
tctaaaaccgctgccgctcccattgagcgtgtcaagcttctcattcaaaaccaagacgaa
atgattcgtgctggtcgtctttctcaccgctacaagggtattggtgagtgtttcaagcgt
actgctgctgaagaaggtgttatttccctttggagaggtaataccgctaatgtcttacgt
tacttccccactcaggccttgaactttgctttcaaggataaatttaagaagatgtttggt
tacaagaaggaaagggatggttatgctaaatggtttgccggtaatttagcctctggtggt
gctgctggtgccgcttcccttttgtttgtctactctcttgactatgcccgtacccgtctt
gccaatgatgccaaatccgccaagaagggaggtgaacgtcaatttaacggtttggtcgat
gtctatcgtaagacctatcgttctgatggtttacgtggtttgtaccgtggttttggccct
tctgttgtcggtattgttgtttaccgtggtttgtacttcggtatgtatgataccttgaaa
cccgtcgttttggttggtcctttggagggcaacttcttggcctccttccttctcggttgg
gccgttaccactggttctggtgttgcttcttatcctcttgataccatccgtcgtcgtatg
atgatgacatctggtgaagccgtcaagtatagctcctcctttgaatgtggtcgtcaaatc
ctcgccaaggaaggtgctcgttctttcttcaagggtgccggtgccaacattcttcgtggt
gttgctggagctggtgtcctttccatttatgaccaagttcaacttttgatgttcggcaag
aagttctaa

DBGET integrated database retrieval system