KEGG   Schizosaccharomyces pombe (fission yeast): SPBC543.06cHelp
Entry
SPBC543.06c       CDS       T00076                                 

Gene name
dbp8
Definition
(RefSeq) putative ATP-dependent RNA helicase Dbp8
  KO
K14778  ATP-dependent RNA helicase DDX49/DBP8 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC543.06c (dbp8)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPBC543.06c (dbp8)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  90S particles
   Helicases
    SPBC543.06c (dbp8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII AAA_22 DUF4351
Motif
Other DBs
NCBI-GeneID: 2541069
NCBI-ProteinID: NP_596794
PomBase: SPBC543.06c
UniProt: Q9HGM5
Position
II:complement(join(4310239..4311346,4311436..4311559,4311627..4311756))
Genome map
AA seq 453 aa AA seqDB search
MSEHTRKSFSDLGISPWLIDTLKALAIYEPTDIQEGVIAQILEGRNCIGGAKTGSGKTAA
FALPIIEKWSKDPSGIFALILTPTRELAIQIDEQFAALGANLNLKHALIVGGMDMIRQSI
DLSKRPHVVVATPGRLADLIRSNGEETIAGLRRIKFLVMDEADRLLSPTFADDLDDCFSV
LPASEDRQTLLFTATVTDAIRQLKYQPQKNNKPPLWLYEVETDNISVPSTLQQSYIFVSS
QVREAYLVHLLTIPENAKKSAIIFVNRTRTAELIYSILRLLELRVTELHSEMVQRERINS
LGRFRAEAAKILVATDVASRGLDIPSVQLVINFDLPRDPDDYIHRVGRTARAGRSGESIS
IVTERDVDLVHAIEDRVGTKLSEYEHVSENKMLEYIKEVTDAKRQASLEMIDRGFGERRQ
KRNEKRLMANGISNKLKNSGRKKKAKNTLSTEK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacatacaagaaaatcattctctgatttaggaatatcgccatggcttatcgat
acgctaaaagcacttgcaatatatgaacctacagatattcaggaaggagtaattgctcag
attttagaaggacgtaattgtattggaggtgctaaaacaggttctggtaaaactgctgct
tttgctttgcctattattgaaaaatggtctaaggatccatcaggaatatttgctcttatt
ttgacaccaaccagagaacttgcaatacagattgatgaacaatttgctgctttaggtgct
aatcttaatttaaagcatgcgctcatcgttggaggcatggatatgatacgacaatctatt
gatttatcgaaacggccccatgttgttgtagctactcctggtcgcctagctgacttgatt
agaagtaatggtgaagaaacgatagccggactacgtcgaataaaatttttggtaatggac
gaagccgaccgtttgttgtctcctacctttgctgatgacttggatgattgcttttctgtt
cttccagcctctgaagatcgtcaaacgcttttgtttactgcaactgttactgatgctatt
cgtcagctcaaatatcagccacagaaaaataataagcctcccctttggttatacgaagtt
gaaactgataacatttccgtaccttctactttgcagcaaagttacatatttgtttcctca
caagtacgagaagcttatttggtgcatttgttaacgattcctgagaacgctaaaaagtct
gcaattatctttgtaaatcggactcgcactgctgaattgatatattctattcttcgattg
ctcgagcttcgtgtcaccgaacttcattcagaaatggtacaacgtgaaaggatcaattca
cttggacggtttcgtgcggaagctgcaaaaattttggtagccactgacgttgcaagcaga
ggtttggatattccttctgtgcaactagtaattaacttcgaccttcctcgtgacccagac
gactatattcaccgagtaggtcgtacagctcgtgctggacgcagtggcgagtccatttcc
attgtaacggagagagatgttgatttagtccatgctattgaggatcgagtaggaactaag
ctttctgaatatgaacacgtgtcagagaataagatgcttgaatacatcaaggaagttacg
gacgctaaacgccaggcttctcttgagatgatcgataggggatttggtgaaaggagacag
aagcgaaacgagaaaaggctgatggccaatggtatttctaataaattaaaaaattctgga
cgcaaaaagaaagcgaagaatactttatctacggaaaagtag

DBGET integrated database retrieval system