KEGG   Schizosaccharomyces pombe (fission yeast): SPBC577.09
Entry
SPBC577.09        CDS       T00076                                 
Symbol
ckn1
Name
(RefSeq) DNA repair ERCC8 family protein ckn1
  KO
K10570  DNA excision repair protein ERCC-8
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
spo04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC577.09 (ckn1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC577.09 (ckn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spo04121]
    SPBC577.09 (ckn1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC577.09 (ckn1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     SPBC577.09 (ckn1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      SPBC577.09 (ckn1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 Nup160 eIF2A Ge1_WD40
Other DBs
NCBI-GeneID: 2540861
NCBI-ProteinID: NP_595307
PomBase: SPBC577.09
Ensembl: SPBC577.09
UniProt: Q9USR0
Position
II:767556..769555
AA seq 404 aa
MNSFLLAREWGQEPNSSFRRQLLQHRLQRLALNPDVKIKRRHGAGILGSVNALSIDNTIH
QLMVSGGANSSINVWDLQNIDQKEDEDLILDTLNAVPARTSHKFGITDLHWFPFDNGIFT
SSSFDHTLKVWDVSTLQEAYTFTMEDMIYSHAWSPIASHCLIATAYRSSSIRLCDMQSGS
YTHSLSGHTGNVLAVDWCPKNEFVLASGSADGTCRLWDIRKVSSSFACMDLHNKYLPSNQ
TNISHYGTVNGLAWTSDARYLASCGTDDRIRVWNMESGRNTLREFGPIIHNQTTSFAVHP
CMIQPSMDSDVFVLFPNDDGSLALLNLLEGSFVRRLSTHSLKRINCAAYRPDFEQCFTGD
MNGNIYMWSPKALKSPTKISDLETRRNIIQEVYDSLINIPVTYQ
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgaattcttttttattggcacgagaatggggccaagagccaaatagctcttttcgaagg
caactactgcagcatcgtcttcaacggttagcgctgaatccggatgtgaaaattaaacgt
agacacggtgcgggcattttaggatccgtaaatgcactaagcattgataatacaattcat
cagctcatggtctctggaggagccaactcgtctatcaatgtttgggacctacaaaatatt
gaccaaaaggaagatgaagatttaattttggataccttaaatgcagttcctgctcgaacg
agtcataagtttggaataacagatttgcattggtttccgtttgataatggtatttttact
agctcgtcgttcgatcatacgctcaaggtttgggatgtttctactttacaggaagcttac
acttttactatggaggacatgatttattcacatgcatggtcgcccattgcatcacattgt
ttaattgccaccgcctaccggtcttcgtctattcggctttgtgatatgcaaagtggtagt
tatactcatagtttgtctggacacacgggtaatgtccttgcggtggattggtgtcctaag
aatgaattcgtgttagcgtccggctctgcagatggcacttgcagactttgggacattcgt
aaagtatcatccagcttcgcatgtatggatctacataataagtatttacccagtaaccag
acaaatatatctcattacggcaccgttaatggattagcttggacttcagatgctcgatat
ttggcaagttgtggtaccgacgatcgaataagagtatggaatatggaaagtggaagaaac
acattgagagaatttggacctattattcataaccagactacttccttcgcggtacatcct
tgcatgatccaaccctctatggattcagatgtttttgtgttattccccaacgatgatggg
tctcttgccttattgaacttgttagaaggctcgtttgtgcgccgactttcaacccacagt
ttaaaacgtattaattgtgctgcctatcgtcctgactttgaacagtgttttactggtgat
atgaatgggaacatttacatgtggtctcctaaagctctaaaatcgcctacgaagatttcg
gatttagaaacaagacgaaacataattcaagaagtatacgactctttaattaatattcca
gtgacttatcaataa

DBGET integrated database retrieval system