KEGG   Schizosaccharomyces pombe (fission yeast): SPBC577.13
Entry
SPBC577.13        CDS       T00076                                 

Gene name
syj2
Definition
(RefSeq) inositol-1,4,5-trisphosphate 5-phosphatase 2
  KO
K20279  synaptojanin [EC:3.1.3.36]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00562  Inositol phosphate metabolism
spo01100  Metabolic pathways
spo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SPBC577.13 (syj2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SPBC577.13 (syj2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC577.13 (syj2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     SPBC577.13 (syj2)
Membrane trafficking [BR:spo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    SPBC577.13 (syj2)
SSDB
Motif
Pfam: Syja_N Exo_endo_phos
Other DBs
NCBI-GeneID: 2541098
NCBI-ProteinID: NP_595311
PomBase: SPBC577.13
UniProt: Q9USQ6
Position
II:join(775773..778006,778052..778270,778316..778367,778418..778582)
AA seq 889 aa
MQCYLKRKERSVAFITEKYAAIIQKPSVKDSDCIITFTCISLEEFEKIKEYELLFGGEKI
LGTLGLFNYVCEDMKEGVFLCVARKAKLVLRIGNRDPISKLENVSFISLDQELWDEELFE
PMPRNSSPSSTFSTSTSDLNNIEKDNLVNSEYSSKYSSTTRIYPYHSLSQLTDLLTDGSF
YVSTNISCFSRFQSEQPYGPKDIYCWNRFLITELDNHFSEAHILEKFPNLLLHCFRGYVE
RMFIDSMSMSIISKVSSYGSRQTYPPSGIDDSSYCSMFVETEFIVEIAQTVFSFVQVRGT
VPCFWEEQFSSWYGPSISFLRSSQASQSLFNFHFSKLYKAYGDIYVIDLLQTKGFEASLY
EAYKHHLMLLPFPAVVKKFHFTPDPARPDIDPRLETDLADDLKEMGYTQKSIENDMLESF
QKGVFRINDLDCLGRTNVIQYQISRLVLKDIFFNLQIGVTFNILEYLRHLWSNNGDAIAK
LITGVGSIGSSATRRGRKSIAGSLSDISKSFGRMYVGRYPDVESQNAILLLLGCFPNQSP
VLISESVSSYIQGVLRQRRSEYRVERDFSIFSSTFNANGKVPSTDEFKRLLLPFGERTSA
YDLYVVAVQEIITLNMSHLVSSSNQKLRIWEEKILMILNSRDSNNKYMLISSIQMAGVFL
GVFIRKDDHLVVSKVTKTTRKTGFGGFSANKGAVAIEMNVCDSDFCFVSSHFAPKVNNIS
ERNMEYTSISDNLVFPSGMKIYDHTNILWMGDFNYRIDSDNEEVRKLVELDDLDKLASYD
QLCTEMKKGTVFHGLVEPQLTFLPTYKFDNGTNDYDTSDKQRVPSWTDRILATKSFTRNC
YKSCDIRCSDHRPVFATFSLKIFSTCMDKKAGIIRDARIAYIKSKNSNK
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgcagtgctatctcaaacgaaaagaaagatctgttgcatttattacagagaaatatgcg
gcaattattcaaaaaccgtctgttaaggattctgattgcataataacattcacttgtatc
tcacttgaagaattcgaaaagataaaggaatatgaattactttttggaggagagaagata
ttgggaacccttgggttgtttaattatgtatgtgaggatatgaaagaaggcgttttccta
tgcgttgcccggaaagcaaaactagtgcttcgaattggtaatagagacccaatttcgaaa
cttgaaaatgtctccttcatctctttagatcaggaattatgggatgaagagttgttcgaa
cccatgcctcgtaatagttcaccaagctctactttttcgacaagcacttctgacttgaat
aatattgaaaaagataatttggttaatagcgaatattctagtaaatactcttcaactact
aggatatatccatatcattccctttctcaattgaccgatttgctcaccgatggttcattt
tatgtctctacaaatatttcttgcttttcaaggtttcaatccgagcagccttatggtccc
aaagatatttattgttggaatagatttctcataacggaattggataaccacttctctgaa
gcccatattttggagaaattcccgaacctgttgctccattgctttcggggttatgttgag
agaatgttcattgatagtatgtctatgagtataatctccaaggtatctagttatggctct
cggcaaacataccctccctctggtattgatgattcgtcttattgttctatgtttgtggag
acagaatttattgtcgagatcgcacaaacggtctttagcttcgtacaagttcgagggaca
gtcccatgtttctgggaggaacaattctcttcttggtatggaccctctatttcttttttg
agatcttcgcaggcaagtcaaagtctatttaattttcactttagtaagctatacaaagct
tatggtgatatatatgtaatcgatcttttacaaacaaaaggctttgaagcttcgctatat
gaagcttacaagcatcaccttatgcttctaccttttcctgccgttgtcaagaaattccac
tttacacctgatcctgctcgtcctgacattgatccacgattagagaccgatttggccgac
gatttaaaagagatgggctatactcaaaagtctattgaaaatgacatgttggaatctttc
caaaaaggagtgtttcggattaatgatttggattgtctgggacgcacaaacgttattcag
tatcaaatatctcgattagtattaaaggatatattttttaaccttcaaataggagtaact
ttcaatattcttgaatacctaagacatctctggtctaataacggtgatgctattgcgaaa
ctaattacaggggttggctccattggttcaagcgctacccgtagaggtcgtaaatctatt
gcgggatctttaagtgatatatccaaatcttttggccgcatgtatgttggaagatatcca
gacgtagaatctcaaaatgccattttattgctgttgggatgttttccgaatcaaagtccc
gtactcatatctgaatccgtgtcttcttacatccaaggtgtgctaagacaacgtcgttct
gaatatagagtcgaaagggattttagcatattttcgtcgacatttaatgcaaatggtaaa
gtacccagcactgatgaatttaaaaggctgttacttccatttggcgaaagaacttccgct
tatgatctttacgttgtagcggttcaagagataattaccttgaacatgagtcatcttgtt
agttcaagcaatcagaaacttaggatttgggaagagaaaatacttatgattctcaattct
cgagattctaataataagtatatgttaattagctctattcaaatggcaggtgttttcctt
ggtgtatttatacggaaggatgatcatcttgttgtttcaaaagttaccaaaacaactcga
aagacaggctttggcgggttttctgccaataagggtgccgttgcaattgaaatgaatgtt
tgcgactcggatttttgttttgtttcttcacatttcgctcctaaggttaataatatttcg
gagcgcaacatggagtatacaagtatatctgataaccttgtttttccatctggaatgaaa
atttatgatcatacgaacattttatggatgggtgattttaattatcgtatagattctgat
aacgaagaagttcgaaaacttgttgaactggacgacttagacaagttggcttcatatgat
cagttatgcacagaaatgaagaaaggcaccgtgtttcatggtttagttgaaccacagtta
acatttcttcctacttacaaatttgataatggaaccaatgattatgacacttcagataaa
cagagagtgccttcatggacagatcgaatcttggccacaaaaagttttactaggaattgc
tataaatcttgtgacattagatgttccgatcatcgtcctgtattcgctactttcagcctt
aaaatattcagtacttgtatggacaagaaagccggaatcataagagacgcaaggattgct
tatattaaaagcaaaaatagtaataaatag

DBGET integrated database retrieval system