KEGG   Schizosaccharomyces pombe (fission yeast): SPBC649.03
Entry
SPBC649.03        CDS       T00076                                 
Symbol
rhp14
Name
(RefSeq) DNA repair protein
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC649.03 (rhp14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC649.03 (rhp14)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     SPBC649.03 (rhp14)
SSDB
Motif
Pfam: XPA_C XPA_N
Other DBs
NCBI-GeneID: 2541120
NCBI-ProteinID: NP_595222
PomBase: SPBC649.03
Ensembl: SPBC649.03
UniProt: O59753
Position
II:536652..538069
AA seq 289 aa
MENSSIVKSPNPTIEEQRNEIEKLKNLTGIEEVHVDGAKVNKRKRTFDEQSEITKDYIEY
DFSKIEDTKGGYLLEEKKVEDLREKPAERELREQEERQKKLRLAPLNLDPETAPKCFECD
SIELDTKYFDIFHCRVCHTCREKYPDKYSLLTKTECKLDYLLTEPELQDQELLPRLLKAN
PHQQGWSNMMLYLRYQVEEFAKKKWGSMEALDAEFERREVQKKEMKEKKFEKQLLELRKR
TRTSNYSRMSIREKRKHVHSYDEEFEKPNEPGVIVQRCKCGLEIEQLEI
NT seq 870 nt   +upstreamnt  +downstreamnt
atggaaaattcgtcaattgtcaagtcaccgaatccaacaatcgaggagcaaagaaatgaa
attgaaaagttaaagaatctcacaggtatagaagaggttcacgttgatggtgcaaaagtt
aataaaaggaagcgtacttttgatgagcagtcggagataaccaaagattacatcgagtat
gatttttccaagattgaagatactaaaggtggttatcttcttgaagaaaagaaagttgaa
gacttaagggagaaaccggctgagcgagagcttagagagcaagaagaacgccaaaaaaag
cttaggctagcacctcttaatctagacccagaaacggcaccaaaatgcttcgagtgcgac
tccatagaattagacacaaaatattttgacatttttcattgtagggtgtgtcatacgtgt
cgggagaaatatccggataaatactccttgctaaccaaaacggagtgcaagttagattat
ttgcttacggaaccggaattgcaagatcaagaacttttacctcgactgttaaaggcaaat
ccacatcagcaaggctggtccaacatgatgttatatcttcgctatcaagttgaggaattt
gcaaagaaaaaatggggttctatggaagctcttgacgcggaatttgagaggagagaagta
caaaagaaggagatgaaagagaagaagtttgaaaagcagcttttggagcttcgaaagaga
acacggacaagtaattacagtcgaatgagtattcgtgaaaagcgaaaacatgttcattct
tatgatgaggaatttgagaaacctaatgaacccggtgtaattgtacaaagatgtaaatgt
ggcttggaaattgagcagctggaaatttaa

DBGET integrated database retrieval system