KEGG   Schizosaccharomyces pombe (fission yeast): SPBC660.13c
Entry
SPBC660.13c       CDS       T00076                                 
Symbol
ssb1
Name
(RefSeq) DNA replication factor A subunit Ssb1
  KO
K07466  replication factor A1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
spo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC660.13c (ssb1)
   03420 Nucleotide excision repair
    SPBC660.13c (ssb1)
   03430 Mismatch repair
    SPBC660.13c (ssb1)
   03440 Homologous recombination
    SPBC660.13c (ssb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spo03000]
    SPBC660.13c (ssb1)
   03032 DNA replication proteins [BR:spo03032]
    SPBC660.13c (ssb1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC660.13c (ssb1)
Transcription factors [BR:spo03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    SPBC660.13c (ssb1)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    SPBC660.13c (ssb1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     SPBC660.13c (ssb1)
   MMR (mismatch excision repair)
     SPBC660.13c (ssb1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     SPBC660.13c (ssb1)
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon DUF223 DUF5521 CDC24_OB3 IBR
Other DBs
NCBI-GeneID: 2541158
NCBI-ProteinID: NP_595092
PomBase: SPBC660.13c
Ensembl: SPBC660.13c
UniProt: Q92372
Position
II:complement(219182..221326)
AA seq 609 aa
MAERLSVGALRIINTSDASSFPPNPILQVLTVKELNSNPTSGAPKRYRVVLSDSINYAQS
MLSTQLNHLVAENKLQKGAFVQLTQFTVNVMKERKILIVLGLNVLTELGVMDKIGNPAGL
ETVDALRQQQNEQNNASAPRTGISTSTNSFYGNNAAATAPAPPPMMKKPAAPNSLSTIIY
PIEGLSPYQNKWTIRARVTNKSEVKHWHNQRGEGKLFSVNLLDESGEIRATGFNDQVDAF
YDILQEGSVYYISRCRVNIAKKQYTNVQNEYELMFERDTEIRKAEDQTAVPVAKFSFVSL
QEVGDVAKDAVIDVIGVLQNVGPVQQITSRATSRGFDKRDITIVDQTGYEMRVTLWGKTA
IEFSVSEESILAFKGVKVNDFQGRSLSMLTSSTMSVDPDIQESHLLKGWYDGQGRGQEFA
KHSVISSTLSTTGRSAERKNIAEVQAEHLGMSETPDYFSLKGTIVYIRKKNVSYPACPAA
DCNKKVFDQGGSWRCEKCNKEYDAPQYRYIITIAVGDHTGQLWLNVFDDVGKLIMHKTAD
ELNDLQENDENAFMNCMAEACYMPYIFQCRAKQDNFKGEMRVRYTVMSINQMDWKEESKR
LINFIESAQ
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggctgagcgattatccgtgggtgcacttcgtataatcaatacatccgatgcttcgtct
tttcctcctaatccaattctccaagtcttaaccgtgaaggagctaaactcaaatccaact
tctggtgctcctaaaagatatcgtgttgtcctttccgattcaatcaattatgcgcaatct
atgttaagcacccagctgaaccatttggttgccgaaaataaacttcaaaaaggagcgttc
gtacagcttacccaattcactgtaaacgttatgaaagaaagaaaaattttgattgttctt
ggtttgaatgttttaactgaacttggcgtaatggataaaattggtaatcccgctggttta
gaaacagttgacgctttacggcagcagcaaaatgagcaaaacaatgctagcgcaccacga
acaggtatttcgacaagcactaactcattttatggaaacaatgctgcagctacagcaccg
gctccacctcccatgatgaagaagccagcagcgccgaatagccttagcacaataatctac
ccaattgaaggtctctctccatatcagaataaatggactattcgtgcccgtgttactaac
aaatctgaggttaaacattggcataatcaacgaggtgaaggaaagctttttagcgtaaat
ttactcgatgaaagtggggagattcgtgcaacaggctttaatgaccaggttgatgctttt
tatgatatcttacaggaaggttcggtttattatatatctcgttgtcgtgtgaacattgca
aaaaaacaatataccaatgttcaaaacgagtatgagctgatgtttgaacgtgatactgaa
ataaggaaagctgaggatcaaactgccgtccccgttgcgaagtttagttttgtttctcta
caagaagtcggcgatgttgccaaagatgctgttatcgatgtaattggtgtactccaaaac
gttggaccagttcaacaaattaccagtcgtgcaacttctcgtggatttgacaagcgtgat
atcactatcgttgaccaaacaggatatgaaatgcgtgttacgctttggggaaagacagct
attgaattctctgtttctgaagaaagtattctcgctttcaaaggagttaaagttaatgac
tttcaaggacgctctttgtcaatgttaactagcagcaccatgtcggtagatccagatatc
caggaatctcatttgttaaaaggttggtatgatggacagggtagagggcaggaatttgcc
aaacatagcgtaatttcatctactttatctactactggaaggagtgctgaacgtaaaaat
attgctgaggttcaagccgaacatctgggaatgtcagaaacacccgattattttagctta
aagggcaccattgtttacattcgaaagaaaaacgtgtcatatcctgcttgccctgctgct
gattgcaacaaaaaggtttttgatcaaggtggctcctggcgatgtgagaaatgtaataaa
gaatatgatgctcctcaataccgttatattataactattgctgtaggtgatcatacggga
caactctggctcaacgtctttgacgacgtcggtaaattaatcatgcataaaacggcagac
gaattgaatgatctacaagaaaacgacgaaaatgcctttatgaattgtatggcagaagct
tgctatatgccatatatctttcaatgtcgtgctaagcaagacaattttaaaggtgaaatg
cgagtacgctatacagtgatgtcaattaatcaaatggactggaaggaagagtctaaaaga
ttgataaatttcattgagtctgctcaataa

DBGET integrated database retrieval system