KEGG   Schizosaccharomyces pombe (fission yeast): SPBC660.16Help
Entry
SPBC660.16        CDS       T00076                                 

Definition
(RefSeq) phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00030  Pentose phosphate pathway
spo00480  Glutathione metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01130  Biosynthesis of antibiotics
spo01200  Carbon metabolism
Module
spo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
spo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SPBC660.16
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SPBC660.16
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     SPBC660.16
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     SPBC660.16
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 2541146
NCBI-ProteinID: NP_595095
PomBase: SPBC660.16
UniProt: P78812
Position
II:join(230368..230384,230446..230450,230616..230679,231497..231564,231737..233061)
Genome map
AA seq 492 aa AA seqDB search
MSQKEVADFGLIGLAVMGQNLILNGADKGFTVCCYNRTTSRVDEFLANEAKGKSIVGAHS
LEEFVSKLKKPRVCILLVKAGKPVDYLIEGLAPLLEKGDIIVDGGNSHYPDTTRRCEELA
KKGILFVGSGVSGGEEGARYGPSLMPGGNPAAWPRIKPIFQTLAAKAGNNEPCCDWVGEQ
GAGHYVKMVHNGIEYGDMQLICETYDIMKRGLGMSCDEIADVFEKWNTGKLDSFLIEITR
DVLRYKADDGKPLVEKILDAAGQKGTGKWTAQNALEMGTPVSLITEAVFARCLSSLKSER
VRASKKLTGPNTKFTGDKKQLIDDLEDALYASKIISYAQGFMLMREAAKEYGWKLNNAGI
ALMWRGGCIIRSVFLKDITEAFREDPNLESILFHPFFTNGVEKAQAGWRRVVAQAAMLGI
PVPATSTGLSFYDGYRSAVLPANLLQAQRDYFGAHTFRVLPEAADKSLPADKDIHINWTG
HGGNISATTYDA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaaaagaagttgccgattttggtctcatcggtttggccgtcatgggtcaaaac
ttgattctcaacggtgccgacaagggctttaccgtctgttgctacaaccgtacaacttcc
agagttgacgagtttttggcaaacgaagccaaaggtaaatctattgttggtgctcactcc
cttgaggaatttgtttccaagcttaagaagcctcgtgtttgtattttgcttgttaaggct
ggtaagcctgttgattaccttattgagggattggctcctctcctcgagaagggcgatatc
attgttgacggtggtaactcccattaccctgatactacccgccgttgcgaggagttggcc
aagaagggcattctttttgttggttccggtgtttctggtggtgaagagggtgctcgttac
ggtccctctttgatgcctggtggtaatcccgctgcctggcctcgtatcaagcccatcttc
caaactttggccgccaaagccggaaacaacgagccttgctgtgactgggttggtgaacaa
ggtgctggtcattatgttaagatggttcacaatggtatcgaatatggtgacatgcaattg
atttgcgaaacttatgacattatgaaacgtggccttggtatgtcttgtgatgagattgcc
gatgtttttgagaagtggaacactggtaaacttgactctttcttaattgaaatcactcgc
gatgttttgcgttacaaggctgatgacggcaagcccttggttgagaagattctcgacgct
gctggacagaagggtactggtaagtggactgctcaaaacgctttggaaatgggtacccct
gtcagtttgatcaccgaagccgtttttgctcgttgtctttcctccttgaagagcgagcgt
gttcgtgcctctaagaagcttactggccccaacaccaagttcactggtgacaagaagcaa
ttgattgatgatttggaagatgccttgtacgcttccaagattatctcttatgctcaaggt
ttcatgcttatgcgtgaggctgctaaggagtacggctggaagcttaacaacgccggtatc
gctttgatgtggcgtggtggttgtattatccgttccgtcttccttaaggatatcactgag
gctttccgtgaggatcctaacctcgagtctatccttttccatcctttcttcactaatggt
gttgaaaaggctcaagctggttggcgtagagttgttgcccaagccgctatgttgggcatt
ccagtccctgccacttctaccggtctttccttctacgacggttatcgtagtgctgttttg
cctgctaacttattgcaagctcaacgtgactactttggtgcccatactttccgtgttttg
cctgaagctgctgataagagcttacctgctgacaaggatatccacattaactggaccggt
cacggtggtaacatcagtgctactacctatgatgcttag

DBGET integrated database retrieval system