KEGG   Schizosaccharomyces pombe (fission yeast): SPBC685.04c
Entry
SPBC685.04c       CDS       T00076                                 

Gene name
aps2
Definition
(RefSeq) putative AP-2 adaptor complex subunit Aps2
  KO
K11827  AP-2 complex subunit sigma-1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPBC685.04c (aps2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC685.04c (aps2)
Membrane trafficking [BR:spo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    SPBC685.04c (aps2)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 2541086
NCBI-ProteinID: NP_596138
PomBase: SPBC685.04c
UniProt: Q9Y7L6
Position
II:complement(2776485..2776916)
AA seq 143 aa
MIQFILIQNRHGKNRLSKYYVPFDDDEKVRLKARIHQLISQRNQKFQANFLEWENSKLVY
RRYAGLYFCFCVDSTDNDLAILEMIHFFVEILDSFFGNVCELDLIFNFYKVSAILDEIIL
GGEIGESNKKSVLERIEALEKLE
NT seq 432 nt   +upstreamnt  +downstreamnt
atgattcaattcattttgatacaaaaccggcatggaaagaatcgactttctaaatactac
gtgccattcgatgatgatgaaaaagttcgattaaaggctcgtatccatcaattgatatct
caaagaaaccaaaaatttcaggcaaatttcctagaatgggagaacagcaagcttgtatac
cgtcggtatgctggcctttatttttgtttttgtgtggattcaaccgataatgatttagcc
attctagagatgattcatttttttgtagaaattcttgattccttctttgggaatgtctgt
gaattagaccttattttcaatttctataaagtcagtgctattcttgacgagataatcctt
ggtggcgaaattggagaatcaaacaaaaaatctgttcttgaaagaattgaagctttagag
aaacttgaataa

DBGET integrated database retrieval system