KEGG   Schizosaccharomyces pombe (fission yeast): SPBC691.03c
Entry
SPBC691.03c       CDS       T00076                                 

Symbol
apl3
Name
(RefSeq) putative AP-2 adaptor complex subunit Alp3
  KO
K11824  AP-2 complex subunit alpha
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPBC691.03c (apl3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC691.03c (apl3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC691.03c (apl3)
Membrane trafficking [BR:spo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    SPBC691.03c (apl3)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPBC691.03c (apl3)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Serinc
Other DBs
NCBI-GeneID: 2541162
NCBI-ProteinID: NP_595595
PomBase: SPBC691.03c
UniProt: Q9C0W7
Position
II:complement(1424670..1427306)
AA seq 878 aa
MVASNNMKGLRAFISDLRSLEHDDEEKRVNVELAKIRAKFQSSTLSAYDRKKYVSKLLYI
YMLGYPITFGHMEAAKLLSGTKYSEKLIGYLAVALLLNENHELMKLVINSIKKDLLSHDS
LQNSLALHTIANIGGRELCETVYYDIYKLLMSASNENIVRQKSALALLHIYRKFPDLINP
EWFEPIVMILGDDDLNVSLAVSNFVNLIVIREPKYQKFAYGKAVGKLKNIVFEHGYSSDY
LYYSVPCPWLQVNLCRILLACERPSDNPTRATLIRVLDRILSLPNDNSNVQQVNAVNAIL
FEAIKLAFLVDESHSLYEKCMDRLADMIADKESNIRYLAFETTAYLISCGHSITSLKHYK
ELILSSLRYKDVSLRKKSLELLYMMCDEENAKLIVADLLQYLPHLDSVTQEDLISKVAII
SETFATDYEWYVDVTIQLLRIAGKSADDGVWHQLVHVIVNNEEIQEYATKRLFSLLQSET
IHECLVKAGGYVLGEFGHLITDYPDSQPVHQFSTIYRKLNVSSPSTRVLLLTTLIKLANL
QPELNDRIAKVFQEYSTIINPEVQQRACEYLQLLKMPRDFLQLVCDEVPPFLDGNRDGVH
PKSRPSSKVNLVDTYPQTIPNVSKPSTPIDVPEYDISACLPGFYRLCWKDKGILYQDSQI
QIGVRSEYHNSEGAIYLYYENRQSNTLKSLSSTLIRTFSTFHLATTFQDTNLPSGVQLQQ
KYVMSGVNEIFEPPIIHVSYVTGVIRSIDLQLPVLLSKFMKPTIFDSYDFFNHWGQMGVE
REAQLTFGLNSKDRKLDAKRLTKIVSGFHWGICQNVDSIALNIVGAGIIRFGTQNVGCLL
RIEPNYEQNLIRLSIRSTNTSIANTLAKEMQEILRNSF
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggtggctagcaacaatatgaaagggcttcgagcgtttatctcggatttgagaagttta
gagcatgacgatgaagagaaacgtgtaaatgttgaattggctaaaattcgtgcaaagttt
caaagttctactttatctgcgtatgaccgaaaaaaatatgtcagcaagcttttatatata
tatatgctgggttatcccatcacttttggccatatggaagctgcaaaactcctttcaggg
acgaagtatagtgaaaaactcattggttatttggcagttgctttgttgctaaacgagaac
catgagttgatgaagttggttataaatagtattaaaaaagatcttttgagtcatgactct
ttacaaaattcgttggccttgcatacaatagccaacattggtggccgagaattatgtgaa
accgtgtactacgacatctataaacttctaatgtcggcaagcaacgaaaatattgttcgt
cagaaatctgccttagctctcctacatatttatcgaaagtttccggatctaatcaaccca
gaatggtttgagccgatagttatgatactaggtgatgatgaccttaacgtttcgttggcg
gtctctaattttgttaatttaatcgtaattcgggagccaaaatatcaaaaatttgcttat
ggaaaagcggttggtaaactgaagaacatagtttttgaacacggttattcaagtgactat
ttgtattattctgtaccttgcccttggctacaggttaatctttgtcgtattctacttgct
tgcgaaaggccttcggacaatcccacaagggcaactctaatacgtgtactagatcgaatc
cttagtttgccaaatgataactcaaacgtacaacaagtaaatgcggtgaatgctatcctt
ttcgaagccatcaaactggcttttctagtcgacgaatctcattctttgtacgaaaaatgt
atggacagacttgctgacatgatcgctgataaagaaagcaatattcggtatttggctttt
gagacgactgcctatctaatttcatgcggacattctatcacttctttaaagcattataag
gaattaatattatcctctttgaggtacaaggatgtttcccttagaaaaaaaagtttagaa
ctcttgtatatgatgtgtgacgaggaaaatgctaaactcatcgttgccgatttattgcag
tatttaccacatcttgactcagtaactcaggaggatcttatttctaaggttgccataatt
tcagagacctttgctaccgactatgaatggtatgtcgatgttactatacaactgcttcgg
atagctggaaaatccgctgatgatggcgtctggcatcagctagttcatgtcattgtgaac
aacgaagaaatccaggaatatgctaccaaacggctattcagcttactacagtctgaaacg
attcatgaatgcttagtcaaagctggaggttatgttcttggtgaatttgggcatttaatt
accgattacccggacagccaacctgttcatcagttttctacaatttatcgtaagctgaat
gtttcttctcccagtacgagggttctgcttttaaccactttaatcaaactggcaaatttg
cagcctgaattgaacgatagaattgcgaaggtttttcaggaatattctactattataaat
ccagaagtacaacaaagagcatgtgaatatcttcaacttttaaaaatgccaagggacttt
ctccaattggtttgtgatgaagttcccccatttttagacggaaatcgagatggagtgcat
ccaaagtcacgtcctagcagcaaggtaaatttggttgatacctatcctcaaaccattccc
aatgtttccaaaccatccacgcccattgatgttccagaatatgacatatcagcatgtctt
cctgggttttatcgtttatgttggaaagataagggaattttgtaccaagattctcaaata
caaattggtgttcgttcagaatatcacaattcagaaggcgccatatatttgtattatgaa
aatcgacagtcaaatacgttgaagtcactctcttcaacgttaattagaaccttttctacc
ttccatttagcaacaacttttcaagatacaaatttgccatcaggagttcaacttcagcaa
aaatatgttatgagtggagttaatgagatattcgaacctccgattattcatgtgtcttat
gttactggtgttatacgttcgatagacctccaattaccggttttgttatcaaaatttatg
aaaccgacaatatttgacagctatgatttctttaaccattggggtcaaatgggagtggaa
agggaagcacagttaactttcggactcaacagcaaagatagaaagcttgacgcaaaacga
ctgacaaaaatagttagtggatttcactggggaatatgccaaaatgttgattctattgcc
cttaatattgtaggagcaggaattattcgatttggtacacagaatgttggatgtttactt
cgtattgaaccaaattacgaacaaaatttgattcgtctatcaattcgttctactaacact
tcaatagcaaatacgttggcaaaagaaatgcaagagattttaaggaattcgttttaa

DBGET integrated database retrieval system