KEGG   Schizosaccharomyces pombe (fission yeast): SPBC713.06
Entry
SPBC713.06        CDS       T00076                                 
Symbol
adl1
Name
(RefSeq) putative DNA ligase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Other DBs
NCBI-GeneID: 2541111
NCBI-ProteinID: NP_595345
PomBase: SPBC713.06
Ensembl: SPBC713.06
UniProt: Q9C1W9
Position
II:877402..882319
AA seq 774 aa
MPPKKRMKNGSSLKSTSKKGEKSRNIITIQDLFSKREAQLTDTPNKLLTDHDQSASDYAY
ALKLQQLFDSENQATAPEKLPKDVIIPEEEYHTDTFNVVKESNDKPKENLVTSEECKASF
FSTDSVNKDSTIDYDALQKDPLTYVKSCRARFVSKDTKSFSYSSLANTFSLISSTKSRIR
IVTLLTNFLLTLLYADPDSLIATVWLCTNSIAPNFYGKNLGVGPAMYSKALKEVCGITAS
ALKNLWNKYGDPGDVAFEAKVSVRTLSRPEPLTIKKVYSTLLKIADSNGNGAQNRKLELT
KFLLISSNAEEVRYIGRSIMQNLRIGAVQNTMLASLSKAFFIFDNQNEIFNFNSDSLQQQ
FRQGEEIVKQSFFQVPDYNILVATLLREGIENLKDNMSIRPGIPVKPMLGSITKNLQHML
ERLTDHNFSCEFKYDGQRAQIHCDRLGNIKIFSRHLEEITGRFPDVIEVAQLALKHSCDF
IIEGELVAIDKSNGQILDFQKLSTRERKKVTVADITIDVCVFVFDIMFCDGKSCLQMPLI
ERRRMFFEHFNLIPNRFQFVSSLETNEEQSIQEFFSLAITNKCEGLMVKVLNGTNSKFPS
TYEPDKRGEGWIKVKQDYDDEFESLDLVPIGAWYGNGRKAGWFSPILLAVYNPDTGAYEA
VCKCMSGFSDQFYKELTQKYSLESGNSSLKPIYNFCETGKVTPQIYFAPQEVWEIKGAQI
TSSPAYKAALGLIQDDRGLSIRFPRFIRVRSDKGPEDASTNSILADMYMKQLNT
NT seq 2325 nt   +upstreamnt  +downstreamnt
atgcctcccaaaaagcgcatgaaaaatggctcttctttaaaatctacgtctaaaaagggt
gagaaaagccgaaatattattacaattcaagatttgttttcaaaacgagaagcacagctt
acagatacaccaaacaaattgctcaccgatcacgatcaaagcgccagcgattatgcttat
gcattaaagcttcaacagctttttgattctgagaaccaagctactgctccggaaaagctt
cctaaagatgtaattatacctgaagaagagtatcatactgacacatttaatgttgtaaaa
gaaagcaatgataaacctaaggagaatttagttacaagcgaagaatgcaaagcttctttt
ttctcaactgatagcgtgaacaaagattccacaattgattacgatgctttacagaaagat
cctttgacttacgtgaaaagttgtcgagcccgatttgtttcaaaagatacaaaaagcttc
agttactcatcacttgctaacaccttttccttaattagttctaccaaatccaggatacgc
attgtcacattattaaccaatttccttctcacacttctgtatgcagatcctgattcctta
attgcaacagtttggttatgtaccaattctattgcccccaacttttatggaaaaaacctt
ggtgtcggacctgcaatgtactctaaagctttgaaagaagtttgtggcattacagcaagt
gctttgaaaaatttatggaacaaatatggcgatccaggagatgtagcgttcgaagctaaa
gtgtctgtgcgcacgttaagcagaccagaacctttgactattaagaaggtttattctact
ttactaaagattgctgacagtaacggtaatggtgcccagaaccgtaaattagagttaact
aaatttttattgataagttctaatgctgaggaggttcgatatatagggaggagtataatg
caaaatctaagaataggggctgttcaaaacaccatgttagcttcactaagcaaagctttt
tttatttttgacaatcaaaacgaaatatttaattttaattctgactcacttcaacaacaa
tttcgtcaaggagaagagattgttaaacaaagtttctttcaggtccctgattataacatt
ttggttgcaacccttcttcgagaggggatagaaaacttaaaagacaatatgtctattcgc
cctggaatcccagtaaaacctatgcttggttctatcacaaagaatttgcagcatatgtta
gaaagattgactgatcataacttctcttgtgagttcaagtacgatggacaaagagcacaa
attcattgcgatagacttggaaacattaagatatttagccgccatttggaggaaattaca
ggaagatttccggatgtcattgaagttgctcaattagcattgaaacattcatgtgatttt
attatagaaggcgaattggtggctattgacaaaagtaatggtcagatactggattttcaa
aaactttcaactagagaaagaaaaaaagttacagtggctgatattacaatagacgtgtgt
gtttttgtttttgatattatgttttgtgatgggaaatcttgcttacaaatgcctttaatt
gaaagaagaagaatgttttttgagcattttaatttaattccaaatcgctttcagttcgtg
tcttctttggaaacaaatgaggagcaatccattcaagaattttttagtcttgcaattact
aataaatgcgaaggattaatggtgaaggtactgaatggaacaaactcaaagtttccttca
acgtatgaacctgataaaagaggtgagggatggattaaagtcaaacaggattatgatgat
gaatttgagtcattggatcttgttcccataggcgcttggtacggtaatggaagaaaagcc
ggatggttcagtccaattttgcttgctgtttacaatccagacactggcgcgtatgaagca
gtctgtaaatgcatgtccggttttagtgaccaattttataaggaattaacacaaaagtat
tccttagaatctggcaatagcagtcttaaacccatatataatttttgcgaaacaggtaag
gtaactccacaaatatactttgcccctcaagaagtttgggaaattaagggtgctcaaata
acatcctcacctgcatacaaggcggctttgggattaattcaggatgatcgcggtttatca
attcgattcccacgcttcattagagttcggtcagacaaaggaccagaggacgcatccacg
aattcaatattggctgacatgtatatgaaacaacttaatacttga

DBGET integrated database retrieval system