KEGG   Schizosaccharomyces pombe (fission yeast): SPBC725.01Help
Entry
SPBC725.01        CDS       T00076                                 

Definition
(RefSeq) putative aspartate aminotransferase
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00220  Arginine biosynthesis
spo00250  Alanine, aspartate and glutamate metabolism
spo00270  Cysteine and methionine metabolism
spo00330  Arginine and proline metabolism
spo00350  Tyrosine metabolism
spo00360  Phenylalanine metabolism
spo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01200  Carbon metabolism
spo01210  2-Oxocarboxylic acid metabolism
spo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPBC725.01
   00270 Cysteine and methionine metabolism
    SPBC725.01
   00220 Arginine biosynthesis
    SPBC725.01
   00330 Arginine and proline metabolism
    SPBC725.01
   00350 Tyrosine metabolism
    SPBC725.01
   00360 Phenylalanine metabolism
    SPBC725.01
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPBC725.01
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPBC725.01
Enzymes [BR:spo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     SPBC725.01
Amino acid related enzymes [BR:spo01007]
 Aminotransferase (transaminase)
  Class I
   SPBC725.01
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 2541186
NCBI-ProteinID: NP_595481
PomBase: SPBC725.01
UniProt: O94320
Position
II:1200661..1201974
Genome map
AA seq 437 aa AA seqDB search
MLARNLRCLHPNTFASLKTNVSYHGVKCLASQSKRGFKVWADVPMGPPDPIFGITEAYKK
DGDVKKMNLGAGTYRDDAGKPYVLPSVRQAETELLSQKLDKEYAPITGIPSFRVQATKLA
YGDVYESIKDRLVSAQSISGTGALCIAANFLASFYPSKTIYVSDPTWGNHKNVFSRAGLT
VKSYKYYDPATRGLDIKGMLSDLTSAPDGSIILLHACAHNPTGVDPTKAQWDDILKTMQK
KNHFALLDMAYQGFASGDFARDAYATRLFASSNVPMLLCQSFAKNMGLYGERAGCFSILA
NDAEEAARIESQTKILIRALYSNPPVNGARIANHILSNPALREQWAGEVVGMSERLKSMR
KALRNILEKDLKNKHSWKHITDQIGMFCYTGLNPQQVDVLAKQYHIYLTKNGRISISGLN
TSNVRYFAEAINAVTSN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgttggccaggaatttgcgttgtttgcatccaaatacatttgcatcgttaaaaaccaac
gtttcctaccatggagtaaaatgcttggcaagtcagagcaagcgtggattcaaggtttgg
gcagatgtacctatgggaccaccggatcccatctttggtattacagaggcctataaaaag
gatggagatgttaagaaaatgaacttgggtgctggtacatatcgtgatgatgccggaaag
ccttatgttctgcccagtgttcgtcaggcagaaactgagctgttgagtcagaaactcgac
aaagaatatgcacccatcacaggaattcccagtttccgtgtgcaagcaacaaaattggct
tatggcgatgtttacgagtctataaaggataggctggtttctgctcaatccattagtggt
accggtgccttgtgtatagcagctaatttccttgcttcattttatccatcaaagactatt
tacgtatctgaccctacttggggaaatcacaagaatgtattttctcgagctggcttgacc
gttaagtcctacaagtattatgatcctgctactcgtgggttggacattaaaggcatgttg
tccgatttaacttcagctcctgatggctctattatattattgcatgcttgtgctcacaat
ccaactggtgtagatcctacgaaagctcagtgggatgatatcctcaaaacaatgcaaaag
aaaaaccattttgctcttttagacatggcttaccaaggatttgccagtggtgattttgct
cgtgatgcttatgccactcgtctgttcgcctccagcaatgtccccatgttactctgccaa
tcctttgctaaaaacatgggtctatatggtgaacgtgctggctgctttagcattttagcc
aacgatgctgaggaagccgctcgtatcgaaagccaaactaagattctcattcgtgctttg
tattccaaccctcccgtcaatggggccagaattgccaaccatatattgagcaaccctgca
cttcgtgaacagtgggctggtgaagttgtaggcatgtccgaacgtcttaagagtatgcgt
aaggctcttcgcaacatccttgaaaaggaccttaagaataaacacagctggaagcatatc
actgaccaaattggtatgttttgttatactggtttaaatccccagcaagttgatgttttg
gctaaacagtatcacatttacctcactaagaatggtcgtattagcatctccggtctcaac
acttccaatgtaagatactttgccgaagctatcaatgccgttacttcgaattag

DBGET integrated database retrieval system