KEGG   Schizosaccharomyces pombe (fission yeast): SPBC725.12
Entry
SPBC725.12        CDS       T00076                                 

Gene name
nbl1
Definition
(RefSeq) borealin N terminal domain-containing protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Nbl1_Borealin_N Eaf7
Other DBs
NCBI-GeneID: 2541173
NCBI-ProteinID: NP_595492
PomBase: SPBC725.12
UniProt: O94328
Position
II:join(1227762..1227876,1227926..1228094,1228166..1228307)
AA seq 141 aa
MMNKRKRVEELGETKHRQVRQRILQEHKNDILENLAFELSDKVRRLRSNASLLASTIRMR
GEMRIAAIPRAQRNMHLRDLKNHLSCNVSATPWRTKIKEFYNLDELSSQKSARQPTKTVA
SSSSSSSKSTTVSKSSSKSQV
NT seq 426 nt   +upstreamnt  +downstreamnt
atgatgaacaagcgtaaaagagtggaagagcttggagagacgaaacatcgtcaagtacga
cagcgaattctccaagaacacaagaacgatatacttgaaaatttagcatttgaactttcc
gataaagtacgacgtttgcgctcaaacgctagtttacttgcttcaacaattcgtatgcga
ggagaaatgcgtatcgccgctattcctcgcgctcaacgaaatatgcatctgcgcgatcta
aagaaccatctttcctgcaatgtgtctgccacaccgtggagaacaaaaataaaagaattt
tataatctagacgagctttcctcccaaaagtccgctagacaacctacaaaaacggtggca
tcctcctcttcttcttcatcaaaaagcaccaccgtttccaaatcgagttcaaagtcgcaa
gtgtga

DBGET integrated database retrieval system