KEGG   Schizosaccharomyces pombe (fission yeast): SPBC776.18c
Entry
SPBC776.18c       CDS       T00076                                 
Symbol
pmh1
Name
(RefSeq) transcription factor TFIIH complex subunit Pmh1
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPBC776.18c (pmh1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC776.18c (pmh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPBC776.18c (pmh1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC776.18c (pmh1)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPBC776.18c (pmh1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPBC776.18c (pmh1)
SSDB
Motif
Pfam: MAT1 zf-C3HC4_5 zf-C3HC4_2 zf-RING_16 zf-RING_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX DUF3797
Other DBs
NCBI-GeneID: 2540684
NCBI-ProteinID: NP_596334
PomBase: SPBC776.18c
Ensembl: SPBC776.18c
UniProt: O94684
Position
II:complement(3211191..3213737)
AA seq 318 aa
MDDEGARKVDEKCPLCQADRYLNPNMKLLINPECYHKMCESCVDRIFTTGPAQCPTPGCN
KILRKAKFREQTFEDAQIEREVDVRKRISRIFNKGQQEFDSLQAYNDYLEEVEILTFNLI
YKIDVEETEEKVKQYEKQNRDSIAANSARAAAEARILAQNEILLKRQKQEAREAAIREHQ
KEKERREQVEQQIIFDLATSGKDPNKIIQLSDSLKKQQENIASSVSNISRSSSILLSDVQ
QVAEDTTPFSPLAGEKDGSKYFSYSKNTYQDLYLEKVSHEPGRKCGFRIEDCHLRCLYEA
FSGIDYDLESLKKLEVAS
NT seq 957 nt   +upstreamnt  +downstreamnt
atggacgatgaaggtgctaggaaagttgatgaaaaatgtccgttgtgccaggcggacaga
tatttaaatccaaatatgaaattacttataaaccctgagtgctatcacaagatgtgtgag
tcttgtgtagacagaatatttacaactggacctgctcaatgccctactcctgggtgcaac
aaaattctcagaaaagccaaatttcgagagcaaacatttgaagatgctcaaattgagcgc
gaagtcgatgttcggaagcggatatctcgaatctttaacaaaggacagcaagaatttgac
agcttgcaggcttacaatgactacttggaagaagttgaaattttaacatttaatttgatt
tataaaatcgacgttgaagaaactgaggaaaaagttaaacaatatgaaaaacaaaatcga
gattctatagcagcaaattctgcaagagccgccgcagaagcacgcattttggctcaaaac
gagattcttctcaaacgccaaaagcaagaagcaagagaagcggctatacgtgagcatcaa
aaagaaaaggaaagacgtgaacaggttgagcaacaaattatttttgatttagctacatca
ggaaaagatcctaacaaaattatccaactatctgattcccttaaaaagcaacaagaaaac
attgcctcttcggtttcaaacatttcacgttcatcttcaattcttctatctgatgttcag
caagtagcagaggatactacgccttttagtcctcttgctggagaaaaagatgggagcaag
tatttttcatactccaaaaacacctatcaagatttatatttggaaaaagtttcgcatgaa
ccaggccgcaaatgcggtttccgtatagaagattgtcatttgcgatgcttatatgaggct
tttagtggcattgattacgatttagaaagtctcaaaaaacttgaagtagcaagttag

DBGET integrated database retrieval system