KEGG   Schizosaccharomyces pombe (fission yeast): SPBC800.02
Entry
SPBC800.02        CDS       T00076                                 

Gene name
whi5
Definition
(RefSeq) putative cell cycle transcriptional repressor Whi5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Whi5
Other DBs
NCBI-GeneID: 2540918
NCBI-ProteinID: NP_595103
PomBase: SPBC800.02
UniProt: Q9HGL9
Position
II:join(253148..253231,253310..253984)
AA seq 252 aa
MAGGHKKNEATRQTDEVIQQKYDESLSKHKNRCELSLTFEYKLSNKLRARLKAAFFKVDH
GWEDQTLDQVETLVRKENHVHRRSRSINDLDSSKLRRPHHPNSIMGSNTGKLRASSFTRL
VSPREGFAQLPYKKPVSPYSSSSAVSSTSSSFDRTSPPWLNYVEPHTELPRLPFELSHAS
TASAKSPLFGMNYHISRPEETDESLRLGTANLSRIRKSTSLPFPTAYPLSADDCKAAEVM
LTLVNSMPSKKP
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcaggcggccacaagaaaaatgaagctacaaggcagactgatgaagttattcaacaa
aaatacgatgaatcattaagcaagcataaaaatcgttgcgaattgtcattaacttttgaa
tacaagttatcaaacaaacttagggctcgtttgaaggcagcgttttttaaggtcgatcat
ggatgggaagatcagacattagatcaagtggaaacgcttgttcgtaaggaaaatcacgtt
catcgtagatcacgctcgatcaatgacttggactcttctaagctaagaaggccgcatcac
cccaactcaattatgggatcgaatacaggcaagctgcgtgcaagttcatttacgcgattg
gtgagcccaagagagggcttcgctcagcttccttataagaagcctgtatctccttactca
tcttctagtgctgtttcttctacgtcctcgtcttttgatagaactagtcctccttggttg
aactacgttgagcctcatactgagctacccagactgccatttgaacttagccatgcctcc
actgcttcagctaaatctccactgttcggaatgaattaccatatttcacgccctgaagaa
accgatgagtctcttcgccttggcactgcaaacctcagtagaattcgcaagtccacgagt
cttccttttccaacggcttatcccctatcggcagatgattgcaaggcagctgaagttatg
cttacgttggtgaattctatgccttcgaaaaaaccataa

DBGET integrated database retrieval system