KEGG   Schizosaccharomyces pombe (fission yeast): SPBC83.04Help
Entry
SPBC83.04         CDS       T00076                                 

Gene name
apc15
Definition
(RefSeq) anaphase-promoting complex subunit Apc15
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Apc15p
Motif
Other DBs
NCBI-GeneID: 2540655
NCBI-ProteinID: NP_595636
PomBase: SPBC83.04
UniProt: O94688
Position
II:join(1516727..1516834,1516902..1517204)
Genome map
AA seq 136 aa AA seqDB search
MSFMSLMANTAHQLWYPTSFPSMKELEKEEVRLETQELAIKQFGFRTIRPIGLNRSMQEQ
LDLEEQEREEANQDTELDEEELGSGSFPEEGEMDDMDGDNEEVEDHDIEEVDLDADITNA
DASEFYEDISEYGFQN
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttatgtcgttgatggctaatacagcccatcaactatggtatcctacgtctttt
ccttctatgaaagaattggaaaaggaagaagttagactggagactcaggagcttgcaatt
aaacagtttggatttcgcactattcggcccattggattaaataggtctatgcaagagcag
cttgatttggaagagcaagagcgcgaagaggctaatcaagacactgagttggatgaagaa
gaattgggaagtgggagctttcctgaagaaggcgaaatggacgatatggatggtgataat
gaagaagtagaagatcacgatattgaagaagtcgacttggatgctgatatcacaaatgct
gacgcctctgaattttacgaagatataagtgaatacggatttcaaaattaa

DBGET integrated database retrieval system