KEGG   Schizosaccharomyces pombe (fission yeast): SPBC83.08
Entry
SPBC83.08         CDS       T00076                                 

Gene name
rvb2
Definition
(RefSeq) AAA family ATPase Rvb2
  KO
K11338  RuvB-like protein 2 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC83.08 (rvb2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPBC83.08 (rvb2)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     SPBC83.08 (rvb2)
  Chromatin remodeling factors
   SRCAP complex
    SPBC83.08 (rvb2)
   INO80 complex
    SPBC83.08 (rvb2)
   INO80 complex (yeast)
    SPBC83.08 (rvb2)
   SWR1 complex
    SPBC83.08 (rvb2)
   ASTRA complex
    SPBC83.08 (rvb2)
SSDB
Motif
Pfam: TIP49 TIP49_C AAA RuvB_N DnaB_C AAA_16 Mg_chelatase AAA_25 AAA_28 Zeta_toxin AAA_19 AAA_33 CPT bpMoxR AAA_7
Other DBs
NCBI-GeneID: 2541077
NCBI-ProteinID: NP_595640
PomBase: SPBC83.08
UniProt: O94692
Position
II:join(1524007..1524055,1524157..1525505)
AA seq 465 aa
MSISVTSHNDVSKLERIGAHSHIKGIGLNDNLEPKESSQGMVGQVKARRAAGVILKMIQE
GRIAGRAILMAGPPSTGKTAIAMGMAQSLGSDTPFVTLSASEVYSLEMSKTEALLQALRK
SIGVRIKEETEIIEGEVVEVQIDRSITGGNKQGKLTIRSTDMETVYDLGTKMIDSLTKEK
VLAGDVISIDKSVGRVTKLGRSFSRARDYDAMGADTRFVQCPQGEIQKRKEVVHTVSLHD
IDVINSRTQGFLALFSGDTGEIKPEVREQINTKVSEWREEGKAEIVPGVLFVDEVHMLDI
ECFSFFNRALEDDLAPIVIMASNRGITRIRGTNYRSPHGIPVDLLDRMLIISTLPYSHEE
VKEILKIRCQEEDVDMEPSALDYLSTIGQETSLRYALLLISSSNQVALKRKSATIEESDI
RRVYELFLDQKRSVEYLEEYGKNYITENEWSASGAQDNAVAMQED
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgtcgatttcggtgacttctcataatgatgtctccaaattagaaagaatcggagcacac
tcccatattaagggaataggtctcaatgataatttagagccgaaggagtcaagccaagga
atggtagggcaagtcaaggctcgcagggctgccggtgtaattctcaaaatgatacaagaa
ggcaggatagctggaagagccatattgatggctggacccccttcaactggtaaaactgct
attgcaatgggaatggctcaatctttaggtagtgacacaccatttgtaacactttctgca
agtgaagtgtactctttggaaatgtcgaaaacagaagccctgttgcaagccttgcgaaaa
agcataggtgtccgtattaaggaggagacagaaattattgaaggagaggttgtggaagtt
caaattgatcggtctattactggcggtaataagcaaggcaagcttacaattcgcagtacc
gacatggaaacggtttatgatttaggaacaaagatgattgattccctcacaaaagaaaag
gttttagctggtgatgttattagtattgataagtcagtgggaagagttactaagctcggt
cgttcattctcgagggcaagggattatgatgctatgggagctgacactcggtttgttcaa
tgtcctcaaggagaaattcaaaaacgaaaggaggtagtccataccgtctccttacatgac
attgatgttattaattcacgtacacaaggattcttagctttgttctcaggtgatactggt
gagattaaaccagaagtacgtgaacaaattaacaccaaagttagtgagtggagagaagaa
ggaaaagccgaaatagtccctggtgtacttttcgttgatgaagttcatatgctagatatt
gagtgcttttcttttttcaatcgcgcattggaagatgacctagctcctatcgttattatg
gcttctaatcgaggaattactcgtattcgaggtacaaattatcgttcccctcatggcatt
ccagttgatttgttagatcgtatgctgattatttctacattgccctattcccatgaagag
gtaaaagaaatcttgaagattcgctgtcaagaagaagatgttgatatggagccttcagct
ttagattacctttccactattggtcaggagactagtcttcgctacgcattacttcttata
tcttcatctaatcaggttgctttgaagcgcaaaagtgctacgattgaggagtccgatatc
cgacgtgtttacgaattatttttggatcaaaaaagaagtgttgaatatttagaggaatac
ggaaagaattacataaccgaaaatgagtggtcggcttcaggtgcacaagataatgcagtt
gcaatgcaggaagattaa

DBGET integrated database retrieval system