KEGG   Schizosaccharomyces pombe (fission yeast): SPBC83.11
Entry
SPBC83.11         CDS       T00076                                 
Name
(RefSeq) putative triose phosphate transmembrane transporter
  KO
K15283  solute carrier family 35, member E1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC83.11
Transporters [BR:spo02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   SPBC83.11
SSDB
Motif
Pfam: TPT EamA
Other DBs
NCBI-GeneID: 2541008
NCBI-ProteinID: NP_595643
PomBase: SPBC83.11
UniProt: O94695
Position
II:join(1529220..1529314,1529377..1530631)
AA seq 449 aa
MVLRERLSHILFHEKVGFLLLCLLWYISSAVTNTTSKSIFNELRCPVTLTFLQFGFVAFF
SAVCLLFRKQFLGGTGIQKPSKYVLYTTLPLSIFQIGGHVFGSLATTKIPVSTVHTVKAL
SPLFTVLAYRFMFRHVYSAMTYFSLVPLTFGVTLACSFELSADIVGLLYALISTCIFVSQ
NIFGSKIFMEAKSHSTHTKKHYNKLNLLLYSSGVAFIVMIPVWLYQEGFAYLPEVGSPVF
LNLIYNGLSHFFQNILAFTLLSIISPVAYSIASLIKRIFVIVVSIIWFQQATNFTQGSGI
FLTAIGLWLYDRSKKGNLYESCKVKEFEKDALELEEQTMEDEKSYPSSGTQSPFYGKNFL
PQITPRLDSVVPLISDSPMTPNSVYSNEGVTSSVSGNATPASVRQSTQNDFSNSNIHDRR
SSYTFQLNNFKAPQPSRLWATETVPTLKI
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggttttgagagagcgacttagccacattttattccatgagaaggtgggatttcttctt
ctttgcttattatggtatatatcaagtgccgttactaatacaacttcaaaaagtattttc
aatgaattacgctgcccggttacattgaccttccttcaatttgggttcgttgcatttttc
agtgccgtttgccttctatttagaaagcaatttcttggtggcacaggtattcaaaaaccc
agtaaatacgttttatatacgactcttccattaagtattttccaaataggaggacacgta
tttggaagtttggctactacgaaaattcccgtctcaactgtacatactgtaaaggcatta
tccccacttttcactgttttagcttatcgcttcatgtttcgccatgtttactctgccatg
acttacttctccttagtgcctctaacatttggcgttaccttggcctgctcttttgaactg
tctgctgatatagtggggcttttgtacgctctaatctcgacttgcatttttgtctcccaa
aatatttttggcagtaaaatatttatggaggcaaaatctcatagcactcacacgaaaaaa
cattacaacaaactaaatcttttactttattcttcaggagtcgcatttatcgttatgatt
cctgtatggctataccaagaaggatttgcctacctccctgaagtcggatcaccggttttc
ctaaatttgatctacaatggtctttctcatttttttcaaaatattctggcttttacccta
ttaagcataatttctcctgttgcatattccatagcaagtctcatcaagcgcattttcgtg
attgtagtttccatcatttggtttcaacaagctacaaattttacccaaggaagtggtatc
tttttgacagctatcggtctctggttgtatgatcgcagtaaaaagggcaatttatacgag
tcttgtaaagtaaaggagtttgaaaaggatgcacttgaattagaagagcaaacaatggaa
gatgaaaagtcctatccttctagtggaacacaatcaccattttatggaaagaatttcctt
cctcaaatcaccccacgtcttgatagtgtggtacctcttatttcagactccccaatgacc
cctaattcagtctattctaatgaaggagttacttcttctgtctcgggtaatgctacacct
gcttctgtgcgtcaaagtacgcaaaatgacttttcaaactccaacatacatgacaggcgt
tccagctatacatttcaattaaacaatttcaaagcccctcaaccctctagactctgggcc
actgaaactgtcccaacattgaaaatttaa

DBGET integrated database retrieval system