KEGG   Schizosaccharomyces pombe (fission yeast): SPBC83.14c
Entry
SPBC83.14c        CDS       T00076                                 
Symbol
rfc5
Name
(RefSeq) putative DNA replication factor C complex subunit Rfc5
  KO
K10756  replication factor C subunit 3/5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC83.14c (rfc5)
   03420 Nucleotide excision repair
    SPBC83.14c (rfc5)
   03430 Mismatch repair
    SPBC83.14c (rfc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC83.14c (rfc5)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC83.14c (rfc5)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC83.14c (rfc5)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    SPBC83.14c (rfc5)
  DNA Replication Termination Factors
   ELG1-RFC complex
    SPBC83.14c (rfc5)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    SPBC83.14c (rfc5)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     SPBC83.14c (rfc5)
  Check point factors
   HRAD17(Rad24)-RFC complex
    SPBC83.14c (rfc5)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA Rad17 Rep_fac_C DNA_pol3_delta AAA_16 AAA_22 ABC_tran Bac_DnaA PLN_propep AAA_27
Other DBs
NCBI-GeneID: 2540215
NCBI-ProteinID: NP_595646
PomBase: SPBC83.14c
Ensembl: SPBC83.14c
UniProt: O94697
Position
II:complement(1534421..1536292)
AA seq 358 aa
MLWLDQYRPKTLASLDYHKQLSERLISLSSTNEFPHLLVYGPSGAGKKTRVVAILRELYG
PGSEKLKIDQRTFLTPSSKKLQINIVSSLHHLEITPSDVGNYDRVIMQELLKDVAQSAQV
DLQAKKIFKVVVINVADELTRDAQAALRRTMEKYSNNIRLILIANSTSKIIEPIRSRTLM
VRVAAPTPEEIILVMSKILTAQGLEAPDSLLNNIANNCDRNLRKAILLLETVHAKSPGNK
QLIDTGAQLPLPDWQTFIQQVGDSMLQEQSPARILAVRSMLYDLLSHCIPPTTILKELLS
FFLSKVDTKLHPYLIQAAANYEHRTRMGNKSIFHLEAFVAYFMKVYAMLQLGMELPSY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgctttggttagatcaataccgtccaaagacgcttgcatctttggactatcacaaacaa
ctctcagaacgtcttatttccttgtcgtctactaatgagtttccccatttgttagtgtat
gggcccagcggagcaggaaaaaaaactcgggtggttgctatattacgagaattgtatgga
cctggctcagagaagttgaaaatcgatcaaagaactttcttgactcctagtagtaaaaaa
ttacagatcaatattgtatcaagtcttcatcatttggaaattacgcccagcgatgtcgga
aattacgaccgagtcattatgcaggagcttttaaaagatgtggctcaatctgcacaagtt
gacttacaagctaaaaagatatttaaagtcgttgtaatcaatgtggctgacgaattaact
agagacgctcaagcggctcttcgtcgtaccatggaaaaatattccaataacattcgtctg
atcttaattgccaattctacgtcgaaaattattgagcctattcgatctcgtacgttaatg
gttcgtgttgcagcccctacgccagaggaaattatcctggtaatgtctaaaatcttgaca
gcccaaggccttgaagctccggattctctgcttaataatatagcgaataattgtgatcgg
aatcttagaaaagccatcttgctcttagagaccgttcatgcaaaatctccaggcaacaag
caactaatcgatactggtgcgcaactccctttgcctgattggcaaacatttatccagcag
gtcggtgattccatgcttcaagaacaaagccctgcacgtatcctggctgttcgctcaatg
ctgtatgatcttctttctcactgcattccccctaccacaattttgaaggaacttctgtct
ttttttctttcaaaagtggacactaaattgcatccatacttaattcaagctgcagcgaat
tatgaacataggactcggatgggcaacaaatcaatttttcacctagaggcttttgttgca
tattttatgaaagtttatgctatgttacaactaggtatggagttaccttcttattag

DBGET integrated database retrieval system