KEGG   Schizosaccharomyces pombe (fission yeast): SPBC83.16cHelp
Entry
SPBC83.16c        CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3808 DUF2892
Motif
Other DBs
NCBI-GeneID: 2541188
NCBI-ProteinID: NP_595648
PomBase: SPBC83.16c
UniProt: O94699
Position
II:complement(1538801..1540492)
Genome map
AA seq 563 aa AA seqDB search
MSKSQEQRLQNFVTVIQGLNDILDDKMDEATEKFKSGNSSFHLSGQAVVAFIQAVLTFEP
SRFKDSQNRIDIAIKALSADKDDASKNNTFLSTFDPGVEYRVSIGLMLLLSALIGFCSES
IVTSVKSVYKLRKAHSIFSKINKRHFDHFSAAFHSTGRSDVDLANEYVQTGTLLCTGLFT
LLISLLPPKMITILNVFGYKGDRDWALQCMWMPALQRPTSFFAAVAFAALIQYYSGAVQL
CSIYKKTPEEPDGWPDKRCFEILEKVEKAHPDGPMWPLHRAKLLSMVKKQDEAIVVLEEL
MAKPPPRLKQLEVLIVFEHALDCAFSHRYVDGANSFLKLSSLNDSSTALYSYFAAACFLQ
DVHVNANVEALEKASKLLEPLHDLVANKTAPLDVHIRRKVGKLIKRRASAGNQGGLAEYV
GFSPLYELVYVWNGFRRMTDDELSKFDVERMEPWQDQDDDICQALIKATVLRNLGRTDEV
FPILQKICAVTRTTETWAVAFAHYEMAVAFFESNGSKKEGLKHCDAYLRKARDFGGDNEF
ESRLIIRVQLARHVVRKCLQSMS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagagtcaagagcaaaggttgcaaaattttgtcaccgtcattcaaggtttgaac
gacatcttggatgacaagatggatgaggctaccgagaaatttaagagcggaaatagttca
ttccatttaagtggtcaagcagtagttgcgtttatccaggcagtgcttactttcgagcct
tcgcgttttaaagattcgcaaaacagaatagacattgctatcaaagccctgtctgctgat
aaagacgatgcttccaaaaacaatacgtttttatcgacttttgatcctggcgttgaatac
agagtttcaattggtttaatgttgttgctttctgcattgattgggttttgttctgagtcg
attgttactagtgtaaaatctgtttacaagttgcgtaaggctcattctattttcagtaaa
atcaataaacgccattttgatcatttttctgctgctttccattcaactggaaggtctgac
gttgaccttgctaatgagtatgttcaaacgggaactttgctttgcaccggtcttttcacc
cttttgatttctcttctaccaccgaaaatgataacaattttgaatgtttttggttacaag
ggtgacagggattgggctctgcaatgtatgtggatgcctgctcttcaaagacctaccagt
tttttcgccgctgtagcatttgctgcattgattcaatactacagtggtgctgttcagcta
tgtagtatttataaaaagactccagaagaacccgatggatggcccgacaaacggtgcttt
gaaattttagagaaggtagaaaaagcacatcctgacggcccaatgtggcctttgcataga
gcgaaacttctatccatggttaagaagcaggatgaagctattgttgttttagaagaactt
atggccaagccccctcctcgtcttaagcaattagaggtcttgattgttttcgaacatgct
cttgattgtgccttttcacaccgttacgtggatggggccaatagctttttaaagctgtcc
agtcttaatgattctagtacggcgctgtattcttattttgctgccgcatgcttcttacag
gatgttcatgtaaatgcaaatgtggaagcactagagaaagcttccaagctacttgaacct
ctacatgatttggttgctaataaaactgcgcctttggacgttcatatcaggaggaaagtt
ggaaaattaattaaacgcagagcgagtgctggtaatcaaggtggtcttgccgagtacgtt
ggattttcacctttatatgaactagtttacgtttggaacggtttccgtagaatgactgat
gatgagctatctaagttcgatgttgaacggatggaaccatggcaagatcaagacgacgat
atttgtcaggcgttgattaaagctactgttttacgtaacttgggtcgcacagacgaagtt
ttccctatccttcaaaaaatatgcgctgttactcgtacaaccgagacatgggctgttgct
tttgctcattatgaaatggcggtagcgttttttgagagcaatggttctaaaaaagaagga
ttgaagcattgtgatgcttatctgagaaaagctcgtgattttggtggagacaacgaattt
gaaagtagattgattattcgtgtgcaacttgcaaggcatgttgttcgaaaatgtcttcaa
tcaatgtcatga

DBGET integrated database retrieval system