KEGG   Schizosaccharomyces pombe (fission yeast): SPBC839.02Help
Entry
SPBC839.02        CDS       T00076                                 

Definition
(RefSeq) arrestin-related trafficking adapter
  KO
K20061  arrestin-related trafficking adapter 3/6
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC839.02
Membrane trafficking [BR:spo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    SPBC839.02
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arrestin_C Arrestin_N
Motif
Other DBs
NCBI-GeneID: 2541205
NCBI-ProteinID: NP_595242
PomBase: SPBC839.02
UniProt: Q8WZK5
Position
II:join(597611..599124,599256..599334)
Genome map
AA seq 530 aa AA seqDB search
MYIPNLRNYHDKVFPYGPSSNGYNPVIRLTDRTTQPDPSQHIYQEEKISKCEGLSYRARE
WLLLSSNSNARVAIALAEPVLYLPGATSSEIQSEHSAVLRGSLCIQIYKPVKLKKIQLSF
KGKSRTEWPEGIPPKLFDTYEENSIMNHCWVFFHSEQKVDENSHGAVWYKVLPHYADTAH
YPRSMECFYPGEYVYNFELPISCTYPESIQTDMGRVYYFLETLVDRSSTFSGKSTGRIPI
ELIRSPCSTSVATSEPILVSKSWEDRLHYEVQVGEKCVVMGQVVPVNFKFTLLGEVKFHK
LRLFLMERRYYYCRQRSVRRKEKTRQLLLYERSAPKNQCLLSDWKQVRPDVYELSDQVRI
PGCHDMAANIVHFDTTYPNIKITHTVRTVLRFSCENSPELMGSAKYLEIYIDSPVRLLSC
RCSDGSTMLPAYCPIIPSSEVNFCSIDNRIIAGMNRDLALDSDIIGNSPPSFDSWTAVPY
QAPPPKYDDIFQSGSSHDENHDDNYFINIFIIFLIIKHMCLITKMFLGLN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtatattcccaatctgagaaattatcacgacaaggtgtttccttacggaccttcttcc
aatggctacaaccctgtaattcgcttgactgatagaaccacacagcctgatccctcgcaa
catatataccaggaagagaaaattagtaaatgtgaaggtctatcatatcgagctcgtgaa
tggcttctgctttcttctaactctaatgccagagtagctattgcgcttgctgaacctgtg
ctctatttacctggagcgacttcaagtgaaattcaaagtgaacattcagctgttttgcgt
ggatctttgtgcattcaaatttataagcctgtgaaattgaaaaagatacaactgagcttt
aaaggaaaatcgagaacagaatggcctgaaggcattcctccaaaactctttgacacatat
gaagagaacagtattatgaatcattgctgggtattttttcattctgaacagaaagtggat
gagaattcacatggtgcagtgtggtacaaagttttgcctcattacgcagataccgcacac
tatccccgcagtatggaatgcttttaccctggagaatacgtgtataattttgagcttcct
atctcttgtacatatccagaatctatacagaccgatatgggtcgtgtatattatttctta
gagacattggtggacagaagcagcaccttctctggtaagtccaccggcaggattcccatt
gaattaattcgtagcccgtgtagtactagtgttgcgacttcagaacctatacttgtctca
aagagttgggaagataggcttcactacgaggttcaagtcggtgagaaatgtgttgtaatg
ggtcaagtagttcctgtcaactttaaattcaccctcttgggtgaagtcaagtttcataaa
cttcgcctttttttaatggagcgaagatattattattgtcgccaacgttcagtccgtcga
aaagagaaaaccagacaactacttctgtatgagcgtagtgctccaaagaaccaatgtttg
ctctccgattggaagcaggttagacctgatgtttacgaactgtctgatcaggtacgtatt
cctggatgtcatgacatggctgccaatattgtgcatttcgatactacgtatccaaacatt
aaaataacacatactgtgcgtacagtacttcgcttttcttgcgaaaattctcctgaatta
atgggctctgcaaaatatttggaaatctatattgattctcctgtccgactcttatcttgc
agatgttctgatggttcaactatgctacctgcgtattgtcctattatcccctctagtgag
gtaaatttttgctcaatcgacaacagaatcattgctggtatgaacagggatctcgcactt
gattctgacattatcggaaattctccaccatcctttgattcctggaccgctgtcccgtat
caagcaccacctccaaagtacgatgatatttttcaaagtggcagcagtcatgatgaaaat
catgatgacaactatttcattaatatattcattatttttcttattattaaacatatgtgt
ctcattactaaaatgtttttagggttaaactag

DBGET integrated database retrieval system