KEGG   Schizosaccharomyces pombe (fission yeast): SPBC839.08c
Entry
SPBC839.08c       CDS       T00076                                 

Gene name
its8
Definition
(RefSeq) putative pig-N family GPI synthesis protein
  KO
K05285  GPI ethanolamine phosphate transferase 1 [EC:2.7.-.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    SPBC839.08c (its8)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     SPBC839.08c (its8)
SSDB
Motif
Pfam: PigN Phosphodiest Metalloenzyme Sulfatase
Other DBs
NCBI-GeneID: 2541199
NCBI-ProteinID: NP_595248
PomBase: SPBC839.08c
UniProt: Q8WZK2
Position
II:complement(join(613507..616163,616316..616466))
AA seq 935 aa
MFGRLLLLGILFHVVFLKSIFDIYFVTPLIHGMKQYSAGEAPAKRLFLIVGDGLRPDKLL
QPHSEKVIGEEQTYAAPFLRSIIQNNGTFGVSHTRVPTESRPGHVALIAGFYEDVSAVTK
GWKKNPVNFDSVFNQSRHTYSFGSEDILPMFSEGASDPSRVDTFMYSSELEDFSSNGIVL
DEWVFDRLDELLAQSLEDKELWDMLHRDKIVFFLHLLGIDTIGHNKHPDSVEYVENIQYI
DGKIQELVDKMNNYYNNDGASSWVFTADHGMSDFGSHGDGNLDNTRTPIIAWGAGIQSPT
HEKNYGHDEYSLPWNLTEIKRIDIQQADIAALMSYLVGLNFPVNSVGQIPLDYLDCSSRR
KAEVALMNALEIGEQYNLKSASKDQTSIFFRPYSPLRNYTEVQASFYNSVIADIESGEYE
IAIEHCFHFSQTVLSGLRYLQRYDWLLLRSIVFFGYLSWIGYVICFVFSLNIEPSSKIVK
PVSVVKRVAFNIPFLLICIFFYIQSSPPFYYGYALFPTIFLQLIHSIFPNTKLGFKNFLT
VAKQKHGFSLLKILFISLCILCLLQFIVYSYFHREGFSVILMGLAAWPWLLHADYAFSHK
TISVSWSVLTSLLCFFTILPVNKKESLLFIFAGGFAMSVAGVFYILYRRNQAFQYSSTVT
NKQLVLQVLIIMATVPVTLKIADSLQRNIAIPPILRLVAFGLFITSYIIPSHHIRSCKHY
FLDRLAILFLTFSPTMCMLSISFEALFYVVLFITLGLWMELETELQKYTEQLHPEYSRKK
DAKFHLSLSHIRISLFFYIFINVAFFGTGNVASLSTFALDSVKRFIPVFNPVTQGALLMY
TILVPFIALSAAFGIMNKRLGGIQQVTFFLAVGMADIVTINFFYLVKDEGSWKDIGVSIS
HFCISNFLILFITALEHASAILCKNITYTIHEKVN
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgtttggtcgcctcttgctgttagggattttattccatgtcgtctttctcaaatccatt
tttgatatctatttcgtaactcctctaatacatggcatgaagcagtattctgcaggcgaa
gctcctgctaaacgcctatttctaattgttggcgatggactacgtcctgataaactatta
caaccacattccgaaaaggtcattggagaagagcagacatatgccgctccatttttaaga
tcaattattcagaataacggtactttcggtgtttctcatactcgtgttcccaccgagtca
cgccccggacatgttgctctaatagctggtttttacgaagatgtttcagccgtcacaaaa
ggctggaaaaaaaatccagtaaatttcgattctgtgtttaatcagagtcggcatacttat
tcgtttggatccgaagatattttgcctatgtttagtgaaggtgcatctgatccatctcga
gttgatacattcatgtattcttctgaattggaggatttctctagcaacggaattgttctt
gacgaatgggtttttgataggctagatgaacttctcgctcagtctttagaggataaggaa
ctttgggatatgttgcatcgggataaaatagtattcttccttcatttactgggcattgac
acaattggccataataaacaccctgactcagttgaatatgtcgaaaacatacagtatata
gatggaaaaattcaagaactcgttgataagatgaacaactactacaataacgacggagcc
tctagctgggtttttacagcagaccatggtatgagtgactttggaagtcatggtgatggc
aaccttgataatacacgtactcccatcattgcctggggtgctggtattcaaagtcctact
catgagaagaattatgggcatgacgagtattctttgccatggaatttgacggagataaaa
cgtattgatatacaacaagcagatattgcagctttaatgtcttaccttgtcggtttaaat
tttcctgtgaattccgtgggtcaaatacccttggattatcttgattgctcttctcgccgc
aaagctgaggttgccttaatgaatgctttagaaattggtgaacaatataatttaaagtct
gcctcaaaggatcaaactagtattttctttcgcccatattctcctttgaggaactataca
gaggtacaagcatccttttacaactcagttattgctgacatagaatctggtgaatatgaa
attgctattgagcattgtttccactttagccaaacggttctttctggactacgttaccta
caacgttacgattggcttcttcttcgatctattgttttctttggttatttgagttggatt
ggatatgtcatatgctttgtcttcagcttaaacatagaaccatcctccaaaatagtaaag
cctgtttccgtcgtcaagagagtcgcatttaatattccttttttgttaatttgcatcttt
ttttatatccagtctagtccaccattttattatgggtatgctcttttcccaaccatattt
ctgcaactcattcattcaattttcccaaataccaaacttggtttcaaaaattttttaaca
gttgcaaagcaaaagcatgggttttctctattaaaaattttgtttatttcgttgtgtatt
ctctgtctgttacaatttatcgtttacagttattttcaccgcgaaggattttccgtaatt
ttaatgggattggccgcatggccatggctccttcatgcggattatgctttttctcacaaa
actatatcagtctcgtggtcagtgcttacgagcttattatgcttttttacgattttacca
gttaataaaaaggaatcgttattatttattttcgctggaggatttgcaatgtcagttgct
ggggttttttatattctttaccgacgaaatcaagcatttcaatatagctcaacggtcaca
aacaaacaattggttttacaagttcttattattatggcaactgtccctgttacgcttaaa
attgcagacagtctgcaaaggaatattgccataccaccaattttacgtttagttgcattt
ggacttttcataacgtcgtacatcattccaagtcatcatattcggtcttgtaaacactat
tttcttgaccgtctggctattttgtttctcacattttcgcctacaatgtgcatgttatct
atttcttttgaagcactcttctatgttgttttatttataacattaggattatggatggaa
ctagaaacagaacttcaaaaatatacggaacaactacatcccgaatatagcagaaagaaa
gatgcaaaattccatttatctctttctcatattcgcatttcccttttcttctacatattt
attaacgtcgcattttttggtacaggaaacgtggcttcactttccacattcgctttggat
tcggtgaaacgttttattcctgtattcaatccggtaacacaaggtgcactcttaatgtac
actattctggttccatttatcgcactttcggcagcttttggaataatgaacaaacgactg
ggagggattcagcaagttactttctttttggcagttggaatggctgatatagttacaatt
aactttttttatttagtaaaggacgaaggctcgtggaaggacattggtgtgagtattagt
catttttgcatcagcaactttttgatactttttattactgctctggaacatgcaagcgcg
attctttgcaaaaatattacctacactattcatgagaaagttaattaa

DBGET integrated database retrieval system