KEGG   Schizosaccharomyces pombe (fission yeast): SPBC839.17c
Entry
SPBC839.17c       CDS       T00076                                 

Gene name
fkh1
Definition
(RefSeq) FKBP-type peptidyl-prolyl cis-trans isomerase Fkh1
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPBC839.17c (fkh1)
Enzymes [BR:spo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPBC839.17c (fkh1)
Chaperones and folding catalysts [BR:spo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    SPBC839.17c (fkh1)
SSDB
Motif
Pfam: FKBP_C
Other DBs
NCBI-GeneID: 2541195
NCBI-ProteinID: NP_595257
PomBase: SPBC839.17c
UniProt: O42993
Position
II:complement(join(631842..631881,631929..632142,632248..632267,632396..632433,632616..632642))
AA seq 112 aa
MGVEKQVISSGNGQDFPKPGDRITMHYTGTLTNGKKFDSSVDRGSPFVCTIGVGQLIRGW
DEGVPKMSLGEKAKLTITPDYGYGPRGFPGLIPPNSTLLFDVELLAINDKKA
NT seq 339 nt   +upstreamnt  +downstreamnt
atgggtgtcgaaaagcaagttatttcttccggaaatggtcaagactttcccaaacctggt
gacagaatcaccatgcattataccggtactttaaccaatggtaaaaagtttgattcatct
gttgaccgtggatccccatttgtttgcactattggcgttggtcaattaattcgcggatgg
gacgaaggagtacccaaaatgagtttgggtgagaaagctaagcttactatcactcctgat
tatggctatggcccacgtggtttccctggattgattcctcctaacagcactcttcttttc
gatgttgagttgcttgctatcaatgataagaaggcttaa

DBGET integrated database retrieval system