KEGG   Schizosaccharomyces pombe (fission yeast): SPBC887.09c
Entry
SPBC887.09c       CDS       T00076                                 

Definition
(RefSeq) putative leucine-rich repeat protein Sog2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: SOG2 LRR_8 LRR_4
Other DBs
NCBI-GeneID: 2541171
NCBI-ProteinID: NP_596483
PomBase: SPBC887.09c
UniProt: O94294
Position
II:complement(3552822..3555482)
AA seq 886 aa
MSAHEVSSTKNSEIERIIKEAEDAGPENALTLDLSHLNLRELPYEQLERIQGRIARLALG
HNFIKSIGPEILKFTRLRYLNIRSNVLREFPESLCRLESLEILDISRNKIKQLPESFGAL
MNLKVLSISKNRLFELPTYIAHMPNLEILKIENNHIVFPPPHIANNDLQDSDMQLFIANI
KGYLSRNESVFRTRSESTVSAALSASANLSHSEENDSSVVDSYLFSAPSDTSHAVSPGML
TFVTPSPHSHSPAGHQQSTPKSTLSKTNENSEGTLYDSNVAHGCTHPPSLNQLNKFHLDA
SPRQARPRRSVSLATGLNSPSVSKPPSSATGPLYHSPQSSLTNSSVASADVQERTHNTNG
ASPIQDQISEFTDQHQNPSNNDAASTQSILKTAPTQLSASAKTSAISLPEVAKKERNRSN
STNDDYSSTRLPSSVLHRLEALKEARKLSEQLPNRIFAQDPHPSPRLKKEETHENGSNLT
NDSVNSYFSNIGGSEVEMKHSAFEKTLESSRGILFSLSQVQQALRQQLLFCSNPVVLDSM
RHVLHTANVQIKRLILCFEDTQQSNDGTANINSIVNASLSCISSFRKLIEVTKKFLNELT
SRADVRYVRLLLLILFDAAKELQNALVPLSPSQPHSGNNIFADQVRQSPTSMIRTASGLT
NRIVSVEKPASVMNPEIDKQIQDQVALATNSAMSVLTLLIDAVPKNNQPDLVNENIAPNL
ISKLRELGSLSAAACDVTRKLKHRLLTFQTNPEELEWQLFLDDTQAFVKSIIAVANLAKA
LSSEYTFQKSVLAGLSAATRSTKDLTILLSSSARHYTESSLATPVPLMSPIARVPATPLS
AALGSAAQSITSPLIMSPAAIPASAYSTNKIDYFTDADGNVEGLQR
NT seq 2661 nt   +upstreamnt  +downstreamnt
atgtctgctcatgaggtgtcctccacaaaaaactcagaaattgaaagaattattaaagag
gcagaagatgcgggtcctgaaaatgcacttacgttagatctatctcatctaaacttgcgg
gaattaccttatgaacaattggaaagaatccagggtcggatagcgagactagcgctaggc
cataactttataaagagtattggtcctgaaatcctaaagtttactcgtctccggtaccta
aatattagatcgaatgtccttagagagtttcccgaatctttgtgtcgacttgagtcactt
gaaattttagacatttctcgcaataaaatcaagcaactgccagaatcctttggagcttta
atgaaccttaaagttctttcaatttctaaaaatcgtctttttgagcttcccacctacatt
gcacatatgccgaatcttgaaattcttaaaattgaaaacaatcacattgtgtttcctcct
ccgcatatcgctaataatgacttgcaagattctgatatgcagttgtttattgccaatata
aagggatatttgtcgcgaaacgaatcagtctttagaacgcgaagtgaaagtactgtttcc
gctgctttatccgcttcagctaatcttagtcactcggaagaaaatgactcctctgtggtt
gattcttacttatttagtgccccatcagatactagccatgcggtttcacctggcatgctg
acgtttgtcacgccaagtccccattcacattctcctgccgggcatcaacagtccacaccc
aaatcgactttgtcaaagacaaatgagaactcagaaggaacattgtatgattcaaatgtt
gctcatggatgcactcatcctccatcacttaatcaattaaacaaatttcatctagatgcg
tcgcctagacaagcccgtcctcgtaggtcagtttctttagctactggcctcaattctcct
tctgtttcaaaaccaccttcttctgctacaggaccattgtaccattcaccccaaagctca
ctcaccaattcctccgtcgctagtgcagacgttcaagaacgtactcacaatactaacggc
gctagccccattcaagaccaaatttcagaattcactgatcaacatcaaaatccctcaaat
aatgatgctgcttccacacaatcgattctaaaaacagctccaacgcagttgagtgcgagt
gctaaaacatcagccataagtttacctgaggttgccaagaaagagcgtaatagaagcaat
agtacaaatgatgattactcttctactagacttccatcgagtgttttacatcgtcttgaa
gcccttaaagaagcgcgcaaactttctgagcaattaccaaatcgaatttttgctcaagat
cctcatccttcccctcgtttgaaaaaagaagaaacgcatgaaaatggctccaatttgaca
aatgactcggtcaacagctacttcagtaacattggagggagtgaggttgaaatgaagcac
tcggcctttgaaaaaactttagagtcgtctaggggcatattgttttcgctttcgcaagtc
caacaagcccttcgtcagcaacttcttttttgcagcaaccccgttgttttagattctatg
cgtcatgtgttacatactgccaatgttcaaattaagcggctaattctgtgctttgaggat
acccaacaaagcaatgatggaactgcaaacattaattccatagtaaacgcttcattgtct
tgtatcagctcgtttcgtaaactaattgaagtgacaaaaaaatttttaaatgagctcact
agtcgtgcggatgtccgatatgttcggcttttactgctaattcttttcgatgctgcaaag
gagttacaaaacgccttggtaccattgagtccatcacaaccccatagtggtaataacata
ttcgccgatcaggtacgtcaatctccgacaagtatgatccggactgcatctgggcttacg
aacagaatcgttagcgttgaaaaaccagcatcagtgatgaatcctgaaattgataaacaa
atacaagatcaggtcgctttagcaacaaacagtgcaatgtcagttttgacattactaatt
gatgctgttcctaaaaataaccagcctgatctagtaaatgaaaacatcgcacccaatttg
attagtaagttacgtgaattgggatcattatccgccgccgcctgtgatgttactagaaaa
cttaagcatcgccttctaacttttcaaacgaatccggaagaattggaatggcagcttttt
ttggacgacactcaagcatttgtcaagtctattattgcagtcgcaaatttagcgaaagcg
ttatccagtgaatatacattccaaaaaagcgtattagctggtctttcagctgcaacaaga
tctacaaaagatcttactatcttactttcttcctctgctcgacattacactgagtcatct
ttagccactcctgttcctttgatgtccccaatagcccgcgtacctgcaacaccgttgtca
gcggctctgggttcggctgctcaatctattacatctcctctaatcatgtcaccagctgca
attccggcgtcagcctatagtactaataaaatcgattactttactgacgcggatgggaac
gtggaaggtttacagcgctaa

DBGET integrated database retrieval system