KEGG   Schizosaccharomyces pombe (fission yeast): SPBC887.12
Entry
SPBC887.12        CDS       T00076                                 

Definition
(RefSeq) putative P-type ATPase
  KO
K14802  phospholipid-transporting ATPase [EC:7.6.2.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC887.12
Enzymes [BR:spo01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     SPBC887.12
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-40S particles
   Other pre-40S particles
    SPBC887.12
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 2541239
NCBI-ProteinID: NP_596486
PomBase: SPBC887.12
UniProt: O94296
Position
II:3561887..3565663
AA seq 1258 aa
MARDVDNKQNAKRISRDEDEDEFAGESMVGRTLDNPFLGEDEFEDIFGSESQYISSSGQN
STNPFLADTRIENSPLGSESKANQLNKQGTNVNHIEIPLRDFNDPTQPESFLPPPKNTFT
SRIKKIKNLFKKEKKQVKPEDLGPRQIILNDYSANHFLHNAVSTCKYSAFTFLPKFLKEQ
FSKYANLFFLFTAVVQQIPGITPVNRYTTIGPMLIVLSVSGIKEIMEDIKRKKQDQELNE
SPCYVLQGTGFVEKQWKDVVVGDIVKIVSETFFPADLVLLSSSEPEGLCYIETANLDGET
NLKIKQALPETAGLLKPVELGQLSGEVKSEQPNNNLYTFDATLKLLPSDRELPLSPDQLL
LRGAQLRNTPWVYGIVVFTGHESKLMKNTTETPIKRTSVEKQVNSQILFLLCIFVFLCFA
SSLGALIHRSVYGSALSYVKYTSNRAGMFFKGLLTFWILYSNLVPISLFVTFELVRYIQA
QLISSDLDMYNEETDTPAACRTSSLVEELGQVGYIFSDKTGTLTRNQMEFRQCTIAGVAY
ADVIPEDRQFTSEDLDSDMYIYDFDTLKENLKHSENASLIHQFLLVLSICHTVIPEYDES
TNSIKYQASSPDEGALVKGAASIGYKFLARKPHLVTVSIFGKDESYELLHICEFNSTRKR
MSIVFRCPDGKIRLYVKGADTVIMERLASDNPYLQTTIHHLEDYATVGLRTLCIAMREVP
EDEYQRWSTVFETAASSLVDRAQKLMDAAEEIEKDLILLGATAIEDRLQDGVPDTISTLQ
TAGIKIWVLTGDRQETAINIGMSCKLIDEDMGLVIVNEETKEATAESVMAKLSSIYRNEA
TTGNVESMALVIDGVSLTYALDFSLERRFFELASLCRAVICCRVSPLQKALIVKMVKRNT
GEVLLAIGDGANDVPMIQAAHVGVGISGMEGLQAVRSSDFSISQFCYLKKLLLVHGSWCY
QRLSKLILYSFYKNIALYMTQFWYAFCNAFSGQVIFESWSISLYNVLFTVLPPVVIGIFD
QFVSAGQLFQYPQLYQLGQRSEFFNLKRFWSWITNGFYHSLLLFLCSIAVFYYDGPNKDG
LASGHWVWGTTLYAAILATVLGKAALISNHWTQYTVIATLGSFLLWIVFMPIYAVAAPAI
GFSKEYYGIIPHLYGNLKFWASLLVLPTIALMRDFVWKYSSRMYYPEEYHYVQEIQKYNV
TDYRPRIVGFHKAIRKIRQMQRMRKQRGYAFSQGEEDQSRILDAYDTTHTRGAYGEMR
NT seq 3777 nt   +upstreamnt  +downstreamnt
atggcccgagatgtagataataagcaaaatgctaaaaggatatcacgagatgaagacgag
gatgaatttgccggagaatcgatggttggtagaacgttagacaatccttttctgggtgaa
gatgaattcgaagatatttttggctctgaaagccaatatatatcttcttcaggccaaaat
tctaccaatccattccttgctgatacaagaatagagaatagtcctttaggaagtgaaagt
aaggccaaccaacttaataagcaaggtacaaacgtaaatcacattgagatacctttgcgc
gattttaatgaccctacacaacctgaatctttcctaccacctcctaagaatacatttact
tcgcgtataaaaaaaataaagaacttatttaaaaaagagaagaaacaggttaagccagaa
gatcttggtcctcgacagatcattttaaatgattattcagcaaaccatttcttacacaac
gctgtgtcaacttgtaaatacagcgctttcacatttttaccaaaattcctaaaggaacaa
ttctcaaaatatgcaaatctatttttccttttcacggctgttgtgcagcaaattcctgga
atcacaccagttaatcgttatacaacgattggccccatgttaattgtactttcagtttct
ggtattaaagaaatcatggaggatataaagcgcaaaaaacaagatcaagaattgaatgaa
tcgccttgctacgttttacaggggactggttttgttgagaaacaatggaaggatgtagtt
gttggtgacattgttaaaatcgtttctgaaacttttttccctgctgacttagtactttta
tcatcatctgagccagagggactatgctatattgagactgcaaatttggatggcgaaact
aatttaaaaattaagcaagctctcccagaaacagcaggtcttctaaaaccagtagagctt
ggtcagctatcaggagaagttaaatcggagcaaccgaataataatttatatacttttgat
gccactttgaagcttcttcccagtgatcgagaacttccattatctcccgatcagttattg
cttcgtggtgctcagcttcgtaatacgccttgggtgtatggcattgttgtatttactggt
catgaatctaaacttatgaagaacactacagaaacacccattaaacgaacttccgtcgag
aagcaagtgaactcacagattctgtttttattatgcatctttgtgtttctttgttttgcc
tcttcacttggagctctcattcatcgttcggtttatggatcagctttatcttatgttaaa
tatacttccaacagggccggcatgtttttcaaagggttgctgactttctggattctctac
tcaaatcttgtgccaatttctttgttcgttacttttgagttagtccgatatatacaggca
cagctaatcagcagtgaccttgatatgtacaatgaggaaactgatactccagctgcatgc
cgcacatcttctctagttgaagaattgggtcaggttggatatatttttagcgacaaaaca
ggtacattgacgagaaatcaaatggaatttcgtcaatgcactatagccggtgttgcatat
gctgatgttattcctgaagatcgtcagtttacctcagaagaccttgattctgatatgtac
atatacgattttgatacgcttaaagaaaatctcaaacatagtgaaaatgcaagccttata
catcagttcttactagttctttctatttgccatacggttatcccagagtatgatgaatcc
actaattcaattaaatatcaagcttcttcaccggatgaaggtgccttagtgaaaggtgct
gcatccattggttataagtttctagcgaggaaaccgcatttagtgactgtaagtattttt
ggaaaagatgaaagttatgaactattacatatttgcgaatttaattctactcgcaaaagg
atgtcaatagtttttcgttgtcctgatggaaaaattcgtttatacgttaaaggtgctgac
acagtcattatggaaaggttagcatccgataacccgtacttacaaactacgattcatcat
cttgaagattatgctaccgtgggtttacgtacgctttgtattgctatgcgggaagtcccg
gaagacgaatatcaaaggtggtcaacagtgtttgaaactgcagcctctagtctggttgac
cgtgctcagaagcttatggatgctgctgaagaaattgaaaaggatttaatcttgctggga
gctaccgctatagaagatagactgcaagatggagttcctgatactatctcaactttacaa
acagctggaataaaaatctgggttctgaccggtgatcgacaagagaccgcaattaatatt
ggcatgagttgcaagttgattgatgaagacatgggtttagttatagtgaacgaagaaacg
aaagaggctactgctgaaagcgtaatggctaagttatcttctatatatcgaaacgaagct
accactggaaatgttgaatcaatggctttggttatagatggggtttcacttacttatgca
ttagattttagcctagaacgccgattctttgaactggcttctttatgccgtgccgtgata
tgttgtcgtgtctcacctttacagaaggctttgatcgttaagatggttaaaagaaataca
ggtgaagtgctattagctattggagatggcgctaatgatgtgccgatgattcaagctgcc
catgttggggttggaatcagcggtatggaagggttacaagcagttcgaagctctgatttt
tcaatttcccaattttgctatttaaaaaaattgttacttgttcacggatcttggtgttat
cagcgtctcagcaaacttattttgtactcgttttacaaaaacattgctctctacatgact
cagttttggtacgctttttgcaatgcattttccggccaggtaatttttgagtcttggtct
atttcactgtataatgtgctttttactgttcttccaccggtggtaataggtatatttgat
cagtttgtaagcgctggtcaactttttcagtatccgcaactttatcaattaggtcaaaga
agtgaattttttaacttaaaaaggttttggtcttggataacaaatgggttttatcattca
cttcttctatttctttgttccattgctgtgttttactatgatggtcctaataaggatggt
ctcgcgtcaggtcattgggtgtggggtactacactttacgctgcaatactagctactgtt
ttaggtaaggctgccttaattagtaatcattggactcaatacactgtaattgctaccctc
ggatctttcttgctatggatagtgtttatgcccatttatgctgttgcagcacccgctatc
ggattttcaaaggagtactacggaataattccacatctttacgggaatctaaaattttgg
gcttccctacttgttttgccaacaatagcactgatgcgtgactttgtgtggaaatattca
tccagaatgtattatcctgaggagtatcattacgttcaagaaattcagaaatataatgtc
acagactatagacctcgtattgtcgggtttcataaagctatcaggaaaataagacagatg
cagagaatgcgtaaacagagagggtatgctttttctcaaggtgaagaggaccagtcaagg
attttagatgcatatgatactacacatactcgtggagcatacggtgaaatgcgttag

DBGET integrated database retrieval system