KEGG   Schizosaccharomyces pombe (fission yeast): SPBC887.18c
Entry
SPBC887.18c       CDS       T00076                                 

Gene name
hfi1
Definition
(RefSeq) SAGA complex subunit Hfi1
  KO
K11362  transcriptional coactivator HFI1/ADA1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPBC887.18c (hfi1)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC887.18c (hfi1)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SPBC887.18c (hfi1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    SAGA complex
     SPBC887.18c (hfi1)
    SLIK complex
     SPBC887.18c (hfi1)
SSDB
Motif
Pfam: SAGA-Tad1
Other DBs
NCBI-GeneID: 2541202
NCBI-ProteinID: NP_596492
PomBase: SPBC887.18c
UniProt: O94301
Position
II:complement(join(3578225..3578700,3578819..3578918,3578970..3579196,3579239..3579455))
AA seq 339 aa
MTEGVTVQKVQSASSNGHKPNTVISQIISEMQSLLGSSFEVYTKTMTDFLIGQLSRKEMK
SMLLTFAGKSNFDKLHNSIIFHILKLMQKNNDTFSALHHLPWFKRKKVDNSLFLHKKISS
QNAQVRLIKRIVMSLSYKDRARIKTALKEKPVTPSLISGLLLETRIAKLPKIPVSRDKLN
SVFVNDIKAGYVAPLACETLELPDSESLKERITAISLENGLLGGVQKGVSDIILAGLESH
LKNILSRCFSILNKNIRQKNTENDAAGFTINDLNLAWTIEPHAFVEQYPQKLRMPFLLHD
SYTEDEISICAESPSYMLASNDAQSDRNSVASLLDEVLS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgacagaaggagttactgtacaaaaagttcaaagcgctagctcgaatgggcacaaaccc
aacacagtaatttcgcaaataatctcagagatgcaatcacttttgggtagcagtttcgag
gtgtatactaaaacaatgacggacttcttaattggacagttgagcagaaaggaaatgaag
tcgatgctgttaactttcgctggaaaatcaaattttgataaactacacaattcaatcatt
tttcatattctcaaattgatgcaaaaaaataatgatacctttagtgctctacatcattta
ccttggtttaaacggaagaaagtcgataatagtttatttttacataaaaaaattagttcg
cagaatgcacaggttcgattaatcaagcgaatagtaatgtctttaagttataaagaccgg
gctaggatcaaaactgctttaaaagaaaagccagttacaccaagtttgatctcaggattg
ctgctggaaacgagaattgcaaaattacctaaaattcctgtatcccgagacaagctgaat
tcagtatttgtaaatgatattaaagccggctatgttgcacctctagcatgtgaaacactt
gaacttccagattcagaatcgttaaaagaacgaattacagctatttctcttgaaaatggc
ttattgggtggtgtacaaaagggtgtgtctgatattatattggctgggttagaaagccat
ctaaagaacattctaagcagatgcttttctatattaaacaaaaatattcgacaaaaaaat
actgaaaatgatgcggcaggttttaccattaatgaccttaatctagcatggactattgaa
cctcatgcttttgtcgaacagtatccacagaagttaagaatgccgtttttgcttcatgat
agttatactgaagatgaaatttcaatttgtgcagaatcgccaagctacatgcttgcaagc
aatgatgcgcaaagtgataggaattctgttgcttcccttttagatgaagtgctttcataa

DBGET integrated database retrieval system