KEGG   Schizosaccharomyces pombe (fission yeast): SPBC8D2.18c
Entry
SPBC8D2.18c       CDS       T00076                                 

Definition
(RefSeq) putative adenosylhomocysteinase
  KO
K01251  adenosylhomocysteinase [EC:3.3.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00270  Cysteine and methionine metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPBC8D2.18c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPBC8D2.18c
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC8D2.18c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     SPBC8D2.18c
Protein phosphatases and associated proteins [BR:spo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPBC8D2.18c
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC8D2.18c
SSDB
Motif
Pfam: AdoHcyase AdoHcyase_NAD 2-Hacid_dh_C IlvN ELFV_dehydrog FdtA TrkA_N
Other DBs
NCBI-GeneID: 2541218
NCBI-ProteinID: NP_595580
PomBase: SPBC8D2.18c
UniProt: O13639
Position
II:complement(1391667..1392968)
AA seq 433 aa
MATQNYKVADISLAAFGRKELEIAENEMPGLIAVREKYAKSQPLKGARIAGCLHMTIQTA
VLIETLVALGAEVTWSSCNIYSTQDHAAAAIAATGVPVFAWKGETEEEYLWCIEQQLKSF
PSGKPLNMILDDGGDLTALVHERHPELLVDIRGISEETTTGVHNLYKMFKENKLKVPAIN
VNDSVTKSKFDNLFGCKESLVDGIKRATDVMIAGKVAVVAGFGDVGKGCSTSLRSQGARV
IVTEVDPINALQAAMDGFEVTTMEEAVKEGQIFVTTTGCRDIIRGEHFNEMKEDSIVCNI
GHFDVEIDVAWLKANAKDVVNIKPQVDRYELKNGRHIILLADGRLVNLGCATGHPSFVMS
CSFTNQVLAQIALWTDNTSYPLGVHMLPKKLDEEVARLHLGKLGVKLTTLTSVQSDYLGI
PVDGPYKADHYRY
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggctactcaaaactacaaagttgctgatatctctcttgctgcctttggtcgcaaggag
ctcgaaatcgctgaaaatgagatgcccggtttgatcgctgttcgcgagaaatatgccaag
tctcagcctttgaagggagcccgtattgctggttgccttcacatgaccatccaaaccgcc
gtcctcatcgaaactttggttgctttgggtgctgaagttacctggtcctcttgcaacatt
tattctactcaagatcatgctgctgctgccattgccgccactggtgtccctgttttcgcc
tggaagggtgagactgaggaagaatacctctggtgtattgagcaacaattgaagtctttc
cctagtggtaagcctttgaacatgattttggatgatggtggagatttgactgctcttgtt
catgagcgtcaccctgaacttttggttgacattcgtggtatctctgaggagaccaccact
ggtgttcacaacttgtacaaaatgttcaaggagaacaagcttaaggttcctgctattaac
gttaacgactctgttaccaagtccaagtttgacaatctttttggatgcaaggagtccttg
gtggatggtatcaagcgtgccactgatgttatgattgctggtaaagttgctgttgttgct
ggttttggtgatgttggtaaaggttgttcaacttctcttcgtagccaaggtgcccgtgtc
attgtcactgaagtcgatcccatcaatgcccttcaagccgctatggacggtttcgaagtc
accactatggaagaggctgttaaggaaggtcaaatctttgttaccaccactggttgccgt
gacattattcgtggtgagcacttcaacgaaatgaaggaggactctatcgtttgtaacatt
ggtcattttgatgtcgagatcgatgtcgcttggttgaaggctaacgctaaggatgttgtt
aacatcaagccccaggttgatcgttatgaattgaagaacggtcgtcatatcattctttta
gctgatggtcgtctcgttaaccttggttgtgccaccggacatccctcttttgttatgtcc
tgctctttcactaaccaggtccttgcccaaatcgctttgtggaccgataacaccagctat
cctcttggtgttcatatgcttcccaagaagttggatgaggaggttgcccgtcttcatttg
ggtaaactcggtgtcaaacttactactttgacttctgttcaatccgactacttgggtatc
cctgttgacggtccttacaaggctgatcactatcgttactaa

DBGET integrated database retrieval system