KEGG   Schizosaccharomyces pombe (fission yeast): SPBC8E4.04
Entry
SPBC8E4.04        CDS       T00076                                 

Definition
(RefSeq) putative aldo/keto reductase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 2541256
NCBI-ProteinID: NP_596843
PomBase: SPBC8E4.04
UniProt: O42888
Position
II:complement(4432418..4433395)
AA seq 325 aa
MSIKEFAKNAREAYFTLPNGDKIPSIGLGTWRSGKDETKNAVCAALKAGYRHIDTAHIYG
NEKEIGEGIRESGVPRTDIWVTSKLWCNAHRAGLVPLALEKTLQDLNLEYIDAYLIHWPF
ALLSGPEELPRNEKGELIYEDVPIEETWQAMEELLETGKVRYIGISNFNNEYLDRVLKIA
KVKPTIHQMELHPYLPQTEYLEKHKKLQIHVSAYSPLANQNDAYNSDISKLIEHKTLVDI
ANARGEGITPANIAISWAVKRGTSVLPKSVNESRIVSNFLYIPLTDKEMEAINNIGVVRR
FSHGKFAPKPMFVGLQDGTPKQTHA
NT seq 978 nt   +upstreamnt  +downstreamnt
atgtcaattaaagaatttgctaagaacgcacgtgaagcttacttcacgcttcctaatggt
gataaaataccttctattgggcttggtacttggagatctggtaaagatgaaaccaagaat
gctgtttgcgctgctttgaaggcaggataccgccacattgatacggctcacatttatgga
aacgaaaaagaaattggtgaaggaattagagagagtggagttccacgtacagatatatgg
gtaacctccaaactgtggtgtaatgcacatcgggcgggactggttccgttggcacttgaa
aagacccttcaggatttaaaccttgaatacattgacgcgtatttgattcattggccattc
gctttactttcgggtcccgaagagttacctagaaatgagaagggtgaattgatatacgaa
gatgttcctattgaagagacatggcaagcaatggaagaacttctcgaaacaggaaaagtt
cgatacattggtatttccaatttcaataatgaatatcttgacagagtactgaaaattgca
aaggtcaagccaacaattcatcaaatggagcttcatccttatttacctcaaactgagtat
ttggagaagcataaaaagcttcaaattcatgtatctgcctactctcctcttgcaaatcaa
aatgatgcatacaatagtgatatttcaaaactcattgagcacaaaactcttgttgacatt
gccaatgctcgtggagaaggtataactcccgctaacattgcaatctcttgggcagtgaag
cgtggtacatcagtgcttcccaaatcagtcaacgaatctcgtatcgtatcaaattttctg
tacatacccctcaccgacaaggaaatggaagcaatcaataacattggtgtagttagacgt
tttagccatggtaagtttgctcccaagccaatgttcgtgggcttacaagatggcacgcct
aaacaaactcatgcttaa

DBGET integrated database retrieval system